Tat (NM_146214) Mouse Tagged ORF Clone

CAT#: MG207246

Reviews ()
Write a review
  • TrueORF®

Tat (GFP-tagged) - Mouse tyrosine aminotransferase (Tat)



  "NM_146214" in other vectors (4)

USD 539.00


Availability*
3 Weeks

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name Tat (NM_146214) Mouse Tagged ORF Clone
Type Mouse Tagged ORF Clone
Tag TurboGFP
Symbol Tat
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Cell Selection Neomycin
Sequence Data
>MG207246 representing NM_146214
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGACTCCTACGTAATCCAGACGAATGTCAATGACAGCCTACCTTCAGTGCTGGATGTTCGCGTCAATA
TTGGCGGGAGAAGCTCGGTGCAAGGGAGAGCGAAGGGCAGGAAGGCCAGGTGGAATGTGAGGCCCTCTGA
CATGTCCAATAAAACCTTCAATCCCATCCGAGCCATTGTGGACAACATGAAGGTGAAGCCGAATCCGAAC
AAAACCGTGATCTCTCTGTCAATTGGGGACCCTACTGTGTTTGGGAACCTGCCCACAGACCCTGAAGTGA
CCCAAGCCATGAAGGATGCCCTGGACTCCGGGAAGTACAATGGCTATGCCCCATCTATCGGCTACCTATC
CAGTCGGGAGGAGGTCGCTTCCTATTACCACTGTCCTGAGGCTCCTCTGGAAGCTAAGGATGTCATTCTG
ACGAGTGGCTGCAGTCAGGCCATTGAGCTGTGTCTAGCCGTGTTGGCCAATCCTGGACAGAACATCCTCA
TTCCGAGGCCCGGGTTTTCCCTCTACAGGACATTGGCTGAGTCTATGGGGATTGAGGTCAAGCTCTACAA
TCTATTGCCTGAGAAGTCTTGGGAAATTGATCTAAAACAACTGGAATCTCTGATCGACGAAAAAACAGCT
TGTCTCGTGGTCAACAACCCGTCCAATCCCTGTGGCTCTGTGTTCAGTAAGCGGCACCTTCAGAAGATTT
TGGCAGTGGCTGAAAGGCAATGCGTCCCCATCTTAGCCGATGAGATCTATGGTGACATGGTGTTTTCAGA
TTGCAAATATGAACCAATGGCCACCCTCAGCACCAATGTCCCCATCCTGTCCTGTGGTGGGCTGGCCAAG
CGCTGGCTGGTTCCTGGCTGGAGGCTGGGCTGGATCCTTATCCATGATCGAAGAGACATTTTTGGCAATG
AGATTCGGGACGGGCTGGTGAAGCTGAGTCAGCGGATCCTGGGCCCGTGCACCATCGTCCAAGGTGCCCT
GAAGAGCATCCTTCAGCGCACCCCTCAGGAGTTCTACCAGGACACTTTAAGCTTCCTTAAGTCCAATGCG
GACCTCTGCTATGGGGCGTTGTCTGCCATTCCTGGACTCCAGCCAGTCCGCCCATCTGGAGCCATGTACC
TTATGGTGGGAATTGAGATGGAGCACTTCCCAGAATTTGAGAATGACGTGGAATTCACAGAGCGGTTAAT
TGCGGAGCAGTCTGTCCACTGCCTCCCAGCCACGTGCTTCGAGTACCCAAATTTCTTCCGGGTTGTCATC
ACAGTCCCCGAGGTGATGATGCTGGAGGCTTGTAGCCGGATCCAGGAGTTCTGTGAACAGCACTACCACT
GTGCTGAAGGCAGCCAGGAGGAGTGTGACAAA


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>MG207246 representing NM_146214
Red=Cloning site Green=Tags(s)

MDSYVIQTNVNDSLPSVLDVRVNIGGRSSVQGRAKGRKARWNVRPSDMSNKTFNPIRAIVDNMKVKPNPN
KTVISLSIGDPTVFGNLPTDPEVTQAMKDALDSGKYNGYAPSIGYLSSREEVASYYHCPEAPLEAKDVIL
TSGCSQAIELCLAVLANPGQNILIPRPGFSLYRTLAESMGIEVKLYNLLPEKSWEIDLKQLESLIDEKTA
CLVVNNPSNPCGSVFSKRHLQKILAVAERQCVPILADEIYGDMVFSDCKYEPMATLSTNVPILSCGGLAK
RWLVPGWRLGWILIHDRRDIFGNEIRDGLVKLSQRILGPCTIVQGALKSILQRTPQEFYQDTLSFLKSNA
DLCYGALSAIPGLQPVRPSGAMYLMVGIEMEHFPEFENDVEFTERLIAEQSVHCLPATCFEYPNFFRVVI
TVPEVMMLEACSRIQEFCEQHYHCAEGSQEECDK

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_146214
ORF Size 1362 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_146214.3
RefSeq Size 2353 bp
RefSeq ORF 1365 bp
Locus ID 234724
UniProt ID Q8QZR1
Cytogenetics 8 57.38 cM
Gene Summary This gene encodes a liver-specific mitochondrial enzyme that catalyzes the conversion of L-tyrosine into p-hydroxyphenylpyruvate. Regulated by glucocorticoid and polypeptide hormones, this gene's expression is affected by deletion of a regulatory region near the albino locus on chromosome 7. Mutations in this gene cause tyrosinemia type II in humans. [provided by RefSeq, Mar 2010]

Other Versions

Frequently bought together (3)
pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
    • 10 ug

USD 704.00


Mouse monoclonal turboGFP antibody, clone OTI2H8
    • 100 ul

USD 385.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 149.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Molbio tools