Bmp7 (NM_007557) Mouse Tagged ORF Clone

CAT#: MG206847

Bmp7 (GFP-tagged) - Mouse bone morphogenetic protein 7 (Bmp7)

Clone Modification / Custom Cloning Service

  • TrueORF®

USD 443.00


Availability*
3 Weeks

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name Bmp7 (NM_007557) Mouse Tagged ORF Clone
Symbol Bmp7
Synonyms OP1
Vector pCMV6-AC-GFP
Sequence Data
>MG206847 representing NM_007557
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCACGTGCGCTCGCTGCGCGCTGCGGCGCCACACAGCTTCGTGGCGCTCTGGGCGCCTCTGTTCTTGC
TGCGCTCCGCCCTGGCCGATTTCAGCCTGGACAACGAGGTGCACTCCAGCTTCATCCACCGGCGCCTCCG
CAGCCAGGAGCGGCGGGAGATGCAGCGGGAGATCCTGTCCATCTTAGGGTTGCCCCATCGCCCGCGCCCG
CACCTCCAGGGAAAGCATAATTCGGCGCCCATGTTCATGTTGGACCTGTACAACGCCATGGCGGTGGAGG
AGAGCGGGCCGGACGGACAGGGCTTCTCCTACCCCTACAAGGCCGTCTTCAGTACCCAGGGCCCCCCTTT
AGCCAGCCTGCAGGACAGCCACTTCCTCACTGACGCCGACATGGTCATGAGCTTCGTCAACCTAGTGGAA
CATGACAAAGAATTCTTCCACCCTCGATACCACCATCGGGAGTTCCGGTTTGATCTTTCCAAGATCCCCG
AGGGCGAAGCGGTGACCGCAGCCGAATTCAGGATCTATAAGGACTACATCCGGGAGCGATTTGACAACGA
GACCTTCCAGATCACAGTCTATCAGGTGCTCCAGGAGCACTCAGGCAGGGAGTCGGACCTCTTCTTGCTG
GACAGCCGCACCATCTGGGCTTCTGAGGAGGGCTGGTTGGTGTTTGATATCACAGCCACCAGCAACCACT
GGGTGGTCAACCCTCGGCACAACCTGGGCTTACAGCTCTCTGTGGAGACCCTGGATGGGCAGAGCATCAA
CCCCAAGTTGGCAGGCCTGATTGGACGGCATGGACCCCAGAACAAGCAACCCTTCATGGTGGCCTTCTTC
AAGGCCACGGAAGTCCATCTCCGTAGTATCCGGTCCACGGGGGGCAAGCAGCGCAGCCAGAATCGCTCCA
AGACGCCAAAGAACCAAGAGGCCCTGAGGATGGCCAGTGTGGCAGAAAACAGCAGCAGTGACCAGAGGCA
GGCCTGCAAGAAACATGAGCTGTACGTCAGCTTCCGAGACCTTGGCTGGCAGGACTGGATCATTGCACCT
GAAGGCTATGCTGCCTACTACTGTGAGGGAGAGTGCGCCTTCCCTCTGAACTCCTACATGAACGCCACCA
ACCACGCCATCGTCCAGACACTGGTTCACTTCATCAACCCAGACACAGTACCCAAGCCCTGCTGTGCGCC
CACCCAGCTCAACGCCATCTCTGTCCTCTACTTCGACGACAGCTCTAATGTCATCCTGAAGAAGTACAGA
AACATGGTGGTCCGGGCCTGTGGCTGCCAC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>MG206847 representing NM_007557
Red=Cloning site Green=Tags(s)

MHVRSLRAAAPHSFVALWAPLFLLRSALADFSLDNEVHSSFIHRRLRSQERREMQREILSILGLPHRPRP
HLQGKHNSAPMFMLDLYNAMAVEESGPDGQGFSYPYKAVFSTQGPPLASLQDSHFLTDADMVMSFVNLVE
HDKEFFHPRYHHREFRFDLSKIPEGEAVTAAEFRIYKDYIRERFDNETFQITVYQVLQEHSGRESDLFLL
DSRTIWASEEGWLVFDITATSNHWVVNPRHNLGLQLSVETLDGQSINPKLAGLIGRHGPQNKQPFMVAFF
KATEVHLRSIRSTGGKQRSQNRSKTPKNQEALRMASVAENSSSDQRQACKKHELYVSFRDLGWQDWIIAP
EGYAAYYCEGECAFPLNSYMNATNHAIVQTLVHFINPDTVPKPCCAPTQLNAISVLYFDDSSNVILKKYR
NMVVRACGCH

TRTRRLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_007557
ORF Size 1290 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_007557.2, NP_031583
RefSeq Size 1987
RefSeq ORF 1293
Locus ID 12162
Cytogenetics 2 H3|2 95.54 cM
Gene Summary This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate each subunit of the disulfide-linked homodimer. Mutation of this gene results in skeletal, kidney, and other developmental defects. [provided by RefSeq, Jul 2016].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.