Acy1 (NM_025371) Mouse Tagged ORF Clone

CAT#: MG206415

Reviews ()
Write a review
  • TrueORF®

Acy1 (GFP-tagged) - Mouse aminoacylase 1 (Acy1)



Reconstitution Protocol

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 657.00


Availability*
3 Weeks

Size
    • 10 ug


Product images

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag TurboGFP
Symbol Acy1
Synonyms 1110014J22Rik; Acy-1
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MG206415 representing NM_025371
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGACCACCAAGGATCCCGAGTCTGAGCACCCCTCCGTGACGCTCTTCCGCCAGTACCTGCGCATCTGCA
CTGTGCAACCCAATCCAGACTATGGAGGGGCCATCACCTTCCTGGAGGAGAGAGCCCGCCAGCTGGGTCT
GAGCTGTCAGAAAATAGAGGTGGTGCCTGGCTTTGTGATCACTGTGCTGACCTGGCCAGGCACCAACCCG
TCACTCCCCTCCATCTTGCTAAACTCCCACACAGATGTGGTACCTGTCTTCAAGGAACATTGGCATCACG
ACCCCTTTGAGGCCTTCAAGGATTCCGAGGGCTACATCTATGCTAGGGGCTCCCAGGACATGAAGAGTGT
CAGCATCCAGTACCTGGAAGCTGTGAGGAGGCTGAAGAGCGAGGGCCACCGATTCCCTAGGACCATCCAC
ATGACCTTTGTGCCTGATGAGGAGGTCGGAGGTCACAAGGGGATGGAGTTGTTTGTGAAGAGGCCTGAGT
TCCAGGCTCTGCGGGCAGGCTTCGCTCTGGACGAGGGCCTGGCCAACCCCACGGATGCCTTTACTGTCTT
TTATAGTGAGCGGAGTCCTTGGTGGGTACGGGTTACCAGCACTGGGAAGCCAGGCCATGCCTCACGCTTC
ATTGAGGATACAGCTGCAGAGAAGTTGCATAAGGTTATAAGCTCCATCTTGGCATTCCGGGAGAAGGAAA
GGCAGAGGCTGCAGGCGAACCCTCACCTGAAGGAAGGCGCTGTGACTTCGGTGAATCTGACCAAGCTTGA
AGGTGGCGTGGCCTATAATGTGGTACCTGCCACTATGAGTGCCAGCTTTGACTTCCGAGTGGCACCAGAT
GTAGACATGAAGGCCTTCGAGAAGCAGCTGCAGAGATGGTGCCAGGAAGCGGGAGAGGGGGTCACCTTTG
AGTTTGCTCAGAAGTTTACAGAGCCTCGAATGACACCCACGGATGATTCAGATCCCTGGTGGGCAGCTTT
CAGCGGAGCCTGCAAGGCAATGAACCTCACTCTGGAGCCAGAGATCTTTCCTGCTGCCACTGACAGCCGC
TATATCCGAGCGGTGGGGATCCCAGCTCTGGGCTTCTCGCCCATGAACCGCACACCTGTCCTGCTACATG
ACCATAATGAACGGCTGCATGAGGATATATTTCTCCGTGGGGTTGACATATATACAGGCCTCCTCTCTGC
ACTTGCTAGTGTGCCCACCCTGCCTGGTGAAAGT


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>MG206415 representing NM_025371
Red=Cloning site Green=Tags(s)

MTTKDPESEHPSVTLFRQYLRICTVQPNPDYGGAITFLEERARQLGLSCQKIEVVPGFVITVLTWPGTNP
SLPSILLNSHTDVVPVFKEHWHHDPFEAFKDSEGYIYARGSQDMKSVSIQYLEAVRRLKSEGHRFPRTIH
MTFVPDEEVGGHKGMELFVKRPEFQALRAGFALDEGLANPTDAFTVFYSERSPWWVRVTSTGKPGHASRF
IEDTAAEKLHKVISSILAFREKERQRLQANPHLKEGAVTSVNLTKLEGGVAYNVVPATMSASFDFRVAPD
VDMKAFEKQLQRWCQEAGEGVTFEFAQKFTEPRMTPTDDSDPWWAAFSGACKAMNLTLEPEIFPAATDSR
YIRAVGIPALGFSPMNRTPVLLHDHNERLHEDIFLRGVDIYTGLLSALASVPTLPGES

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_025371
ORF Size 1224 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_025371.1, NP_079647.1
RefSeq Size 1432 bp
RefSeq ORF 1227 bp
Locus ID 109652
UniProt ID Q99JW2
Cytogenetics 9 57.49 cM
Gene Summary Involved in the hydrolysis of N-acylated or N-acetylated amino acids (except L-aspartate).[UniProtKB/Swiss-Prot Function]
Other products for "Acy1"
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.