Agtr1a (NM_177322) Mouse Tagged ORF Clone

CAT#: MG205480

Agtr1a (GFP-tagged) - Mouse angiotensin II receptor, type 1a (Agtr1a)

Clone Modification / Custom Cloning Service

  • TrueORF®

USD 443.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name Agtr1a (NM_177322) Mouse Tagged ORF Clone
Symbol Agtr1a
Synonyms 1810074K20Rik; AG2S; Agtr-1a; Agtr1; AI551199; Angtr-1a; AT1; AT1a; AT2R1; AT2R1A
Vector pCMV6-AC-GFP
Sequence Data
ORF Nucleotide Sequence
>MG205480 representing NM_177322
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCCTTAACTCTTCTACTGAAGATGGCATCAAAAGAATTCAAGATGACTGCCCCAGGGCTGGCAGGC
ACAGTTACATATTTGTCATGATCCCTACTCTCTACAGCATCATCTTTGTGGTGGGAATATTTGGAAACAG
CTTGGTGGTGATCGTCATCTACTTTTACATGAAGCTGAAGACTGTGGCCAGTGTCTTTCTTCTAAATCTC
GCCCTGGCTGACTTATGCTTTTTGCTGACTTTGCCCCTGTGGGCTGTCTATACCGCTATGGAATACCGCT
GGCCCTTCGGCAATCACCTATGTAAGATCGCTTCGGCCAGCGTCAGTTTCAACCTCTACGCCAGCGTGTT
CCTGCTCACGTGTCTCAGCATCGATCGCTACCTGGCCATTGTCCACCCGATGAAGTCTCGCCTCCGCCGC
ACGATGCTGGTGGCCAAAGTCACCTGCATCATCATCTGGCTGATGGCTGGCTTGGCCAGTTTGCCAGCCG
TCATCCACCGAAATGTGTATTTCATTGAGAACACCAATATCACTGTTTGCGCTTTTCATTACGAGTCCCG
GAATTCAACGCTCCCCATAGGACTGGGCCTAACCAAGAACATCCTGGGCTTCCTGTTCCCTTTCCTAATC
ATTCTTACCAGCTATACTCTTATATGGAAAGCTCTAAAGAAGGCTTATGAAATTCAGAAGAACAAGCCAA
GAAATGATGACATCTTTAGGATAATTATGGCGATTGTGCTTTTCTTCTTCTTCTCCTGGGTCCCCCACCA
AATATTCACATTCCTGGATGTGCTGATTCAGCTGGGCGTCATCCATGACTGTAAAATTGCCGACATCGTG
GACACTGCCATGCCCATAACCATCTGCATAGCGTATTTTAACAACTGCCTGAACCCTCTGTTTTACGGCT
TTCTGGGGAAAAAATTTAAAAAGTATTTCCTCCAGCTCCTGAAATATATTCCCCCAAAGGCCAAGTCGCA
CTCAAGCCTGTCTACGAAAATGAGCACGCTCTCCTACCGCCCCTCAGATAACATGAGCTCAGCCGCCAAA
AAGCCTGCGTCTTGTTCTGAGGTGGAG


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>MG205480 representing NM_177322
Red=Cloning site Green=Tags(s)

MALNSSTEDGIKRIQDDCPRAGRHSYIFVMIPTLYSIIFVVGIFGNSLVVIVIYFYMKLKTVASVFLLNL
ALADLCFLLTLPLWAVYTAMEYRWPFGNHLCKIASASVSFNLYASVFLLTCLSIDRYLAIVHPMKSRLRR
TMLVAKVTCIIIWLMAGLASLPAVIHRNVYFIENTNITVCAFHYESRNSTLPIGLGLTKNILGFLFPFLI
ILTSYTLIWKALKKAYEIQKNKPRNDDIFRIIMAIVLFFFFSWVPHQIFTFLDVLIQLGVIHDCKIADIV
DTAMPITICIAYFNNCLNPLFYGFLGKKFKKYFLQLLKYIPPKAKSHSSLSTKMSTLSYRPSDNMSSAAK
KPASCSEVE

TRTRRLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_177322
ORF Size 1077 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_177322.3, NP_796296
RefSeq Size 2284
RefSeq ORF 1080
Locus ID 11607
Cytogenetics 13 A3.2|13 13.19 cM
Gene Summary Receptor for angiotensin II. Mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system. [UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)