Anxa1 (NM_010730) Mouse Tagged ORF Clone

CAT#: MG205210

Anxa1 (GFP-tagged) - Mouse annexin A1 (Anxa1)

Change vector?

  • TrueORF®

USD 443


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name Anxa1 (NM_010730) Mouse Tagged ORF Clone
Symbol Anxa1
Synonyms Anx-1; Anx-A1; C430014K04Rik; Lpc-1; Lpc1
Vector pCMV6-AC-GFP
Sequence Data
ORF Nucleotide Sequence
>MG205210 representing NM_010730
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCAATGGTATCAGAATTCCTCAAGCAAGCCCGTTTTCTTGAAAATCAAGAACAGGAATATGTTCAAG
CTGTAAAATCATACAAAGGTGGTCCTGGGTCAGCAGTGAGCCCCTACCCTTCCTTCAATGTATCCTCGGA
TGTTGCTGCCTTGCACAAAGCTATCATGGTTAAAGGTGTGGATGAAGCAACCATCATTGACATTCTTACC
AAGAGGACCAATGCTCAGCGCCAGCAGATCAAGGCCGCGTACTTACAGGAGAATGGAAAGCCCTTGGATG
AAGTCTTGAGAAAAGCCCTTACAGGCCACCTGGAGGAGGTTGTTTTGGCTATGCTAAAAACTCCAGCTCA
GTTTGATGCAGATGAACTCCGTGGTGCCATGAAGGGACTTGGAACAGATGAAGACACTCTCATTGAGATT
TTGACAACAAGATCTAACGAACAAATCAGAGAGATTAATAGAGTCTACAGAGAAGAACTGAAAAGAGATC
TGGCCAAAGACATCACTTCAGATACATCTGGAGACTTTCGGAAAGCCTTGCTTGCTCTTGCCAAGGGTGA
CCGTTGTCAGGACTTGAGTGTGAATCAAGATTTGGCTGATACGGATGCCAGGGCTTTGTATGAAGCTGGA
GAAAGGAGAAAGGGGACAGACGTGAACGTGTTCACTACAATTCTGACCAGTAGGAGCTTTCCTCATCTTC
GCAGAGTGTTTCAGAATTACGGAAAGTACAGTCAACATGACATGAACAAAGCTCTGGATCTGGAACTGAA
GGGTGACATTGAGAAGTGCCTCACAACCATCGTGAAGTGTGCCACCAGCACTCCAGCTTTCTTTGCCGAG
AAGCTGTACGAAGCCATGAAGGGTGCCGGAACTCGCCATAAGGCATTGATCAGGATTATGGTCTCCCGTT
CGGAAATTGACATGAATGAAATCAAAGTATTTTACCAGAAGAAGTATGGAATCTCTCTTTGCCAAGCCAT
CCTGGATGAAACCAAAGGAGACTATGAAAAAATCCTGGTGGCTCTGTGTGGTGGAAAC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>MG205210 representing NM_010730
Red=Cloning site Green=Tags(s)

MAMVSEFLKQARFLENQEQEYVQAVKSYKGGPGSAVSPYPSFNVSSDVAALHKAIMVKGVDEATIIDILT
KRTNAQRQQIKAAYLQENGKPLDEVLRKALTGHLEEVVLAMLKTPAQFDADELRGAMKGLGTDEDTLIEI
LTTRSNEQIREINRVYREELKRDLAKDITSDTSGDFRKALLALAKGDRCQDLSVNQDLADTDARALYEAG
ERRKGTDVNVFTTILTSRSFPHLRRVFQNYGKYSQHDMNKALDLELKGDIEKCLTTIVKCATSTPAFFAE
KLYEAMKGAGTRHKALIRIMVSRSEIDMNEIKVFYQKKYGISLCQAILDETKGDYEKILVALCGGN

TRTRRLE - GFP Tag - V
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_010730
ORF Size 1038 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_010730.2, NP_034860
RefSeq Size 1395
RefSeq ORF 1041
Locus ID 16952
Cytogenetics 19 B|19 13.83 cM
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations