Taldo1 (NM_011528) Mouse Tagged ORF Clone

CAT#: MG205018

Reviews ()
Write a review
  • TrueORF®

Taldo1 (tGFP-tagged) - Mouse transaldolase 1 (Taldo1)



Reconstitution Protocol

USD 657.00

3 Weeks*

Size
    • 10 ug

Product images

Frequently bought together (4)
pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
    • 10 ug

USD 750.00


Mouse monoclonal turboGFP antibody, clone OTI2H8
    • 100 ul

USD 412.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Other products for "Taldo1"

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag TurboGFP
Symbol Taldo1
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MG205018 representing NM_011528
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCGGGGTCCCCGGTAAAGCGCCAGAGGATGGAGTCCGCCTTGGACCAGCTCAAGCAGTTCACCACCG
TGGTGGCCGACACGGGTGATTTCAATGCCATCGATGAATACAAGCCCCAAGATGCCACCACCAACCCATC
CCTGATCCTGGCTGCAGCCCAGATGCCTGCCTACCAAGAGCTGGTAGAGGAGGCCATTGCCTACGGCAAG
AAGCTGGGTGGGCCTCAAGAGGAGCAGATTAAAAATGCCATTGACAAACTTTTTGTGCTGTTTGGAGCAG
AAATATTAAAGAAGATTCCAGGCCGTGTATCCACAGAAGTTGATGCAAGGCTTTCCTTTGATAAGGATGC
CATGGTGGCCCGAGCCAGGCGCCTCATCGAGCTTTACAAAGAAGCTGGGGTCGGCAAGGACAGAATTCTC
ATCAAGTTATCATCAACCTGGGAGGGGATTCAGGCTGGAAAGGAGCTGGAGGAACAGCATGGCATCCACT
GCAACATGACACTGCTTTTCTCCTTCGCCCAGGCTGTGGCCTGTGCTGAGGCGGGCGTGACGCTCATCTC
TCCCTTTGTGGGGCGCATCCTTGATTGGCATGTGGCAAACACAGACAAGAAATCCTATGAACCCCAGGAG
GACCCTGGGGTCAAGAGTGTCACCAAAATCTACAACTACTACAAGAAGTTCGGCTACAAGACCATTGTCA
TGGGCGCCTCCTTCCGCAACACGGGCGAGATCAAAGCACTGGCGGGCTGTGACTTCCTCACCATCTCCCC
GAAGCTCCTGGGGGAGCTGCTCAAGGATAACAGCAAGCTGGCGCCTGCGCTCTCTGTCAAGGCGGCCCAG
ACCAGTGACTCGGAGAAGATACATCTGGACGAGAAGGCCTTCCGTTGGCTGCACAACGAAGACCAAATGG
CCGTGGAGAAGCTCTCCGACGGCATCCGCAAATTTGCTGCTGATGCCATAAAGTTGGAGCGGATGCTCAC
GGAACGAATGTTCAGCGCTGAGAACGGGAAG


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>MG205018 representing NM_011528
Red=Cloning site Green=Tags(s)

MSGSPVKRQRMESALDQLKQFTTVVADTGDFNAIDEYKPQDATTNPSLILAAAQMPAYQELVEEAIAYGK
KLGGPQEEQIKNAIDKLFVLFGAEILKKIPGRVSTEVDARLSFDKDAMVARARRLIELYKEAGVGKDRIL
IKLSSTWEGIQAGKELEEQHGIHCNMTLLFSFAQAVACAEAGVTLISPFVGRILDWHVANTDKKSYEPQE
DPGVKSVTKIYNYYKKFGYKTIVMGASFRNTGEIKALAGCDFLTISPKLLGELLKDNSKLAPALSVKAAQ
TSDSEKIHLDEKAFRWLHNEDQMAVEKLSDGIRKFAADAIKLERMLTERMFSAENGK

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_011528
ORF Size 1011 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_011528.4
RefSeq Size 1238 bp
RefSeq ORF 1014 bp
Locus ID 21351
UniProt ID Q93092
Cytogenetics 7 F5
Gene Summary This gene encodes a key enzyme of the nonoxidative pentose phosphate pathway that provides ribose-5-phosphate for nucleic acid synthesis and nicotinamide adenine dinucleotide phosphate (NADPH) for lipid biosynthesis. The encoded protein is important for maintaining structure and function of mitochondria. Studies in knockout mice identify that deficiency of this gene product is a cause of sperm dysmotility and male infertility. Deficiency of this protein has also been identified as a cause of hepatocarcinogenesis in mice. Two related pseudogenes have been identified on chromosome 10. [provided by RefSeq, Mar 2010]
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.