(BC055922) Mouse Tagged ORF Clone

CAT#: MG204249

(GFP-tagged) - Mouse cDNA clone MGC:68320 IMAGE:4193319

Change vector?

  • TrueORF®

USD 763.00


Availability*
3 Weeks

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name (BC055922) Mouse Tagged ORF Clone
Vector pCMV6-AC-GFP
Sequence Data
ORF Nucleotide Sequence
>MG204249 representing BC055922
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGCTGCAGGCTTCTCCTCTATGTTTCCCTATGTCTTGTGGAAACAGCACTCATGAACACTAAAATTA
CTCAGTCACCAAGATATCTAATCCTGGGAAGAGCAAATAAGTCTTTGGAATGTGAGCAACATCTGGGACA
TAATGCTATGTACTGGTATAAACAGAGCGCTGAGAAGCCGCCAGAGCTCATGTTTCTCTACAGTGTTAAA
CAATTGATTCGAAATGAGACGGTGCCCAGTCGTTTTATACCTGAATGCCCAGACAGCTCCAAGCTACTTT
TACATGTATCTGCCGTGGATCTAGAAGACTCAGCTGTCTATTTTTGTGCCAGCAGCCGGGGGCTCCAAGA
CACCCAGTACTTTGGGCCAGGCACTCGGCTCCTCGTGTTAGAGGATCTGAGAAATGTGACTCCACCCAAG
GTCTCCTTGTTTGAGCCATCAAAAGCAGAGATTGCAAACAAACAAAAGGCTACCCTCGTGTGCTTGGCCA
GGGGCTTCTTCCCTGACCACGTGGAGCTGAGCTGGTGGGTGAATGGCAAGGAGGTCCACAGTGGGGTCAG
CACGGACCCTCAGGCCTACAAGGAGAGCAATTATAGCTACTGCCTGAGCAGCCGCCTGAGGGTCTCTGCT
ACCTTCTGGCACAATCCTCGAAACCACTTCCGCTGCCAAGTGCAGTTCCATGGGCTTTCAGAGGAGGACA
AGTGGCCAGAGGGCTCACCCAAACCTGTCACACAGAACATCAGTGCAGAGGCCTGGGGCCGAGCAGACTG
TGGAATCACTTCAGCATCCTATCATCAGGGGGTTCTGTCTGCAACCATCCTCTATGAGATCCTACTGGGG
AAGGCCACCCTATATGCTGTGCTGGTCAGTGGCCTGGTGCTGATGGCCATGGTCAAGAAAAAAAATTCC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>MG204249 representing BC055922
Red=Cloning site Green=Tags(s)

MSCRLLLYVSLCLVETALMNTKITQSPRYLILGRANKSLECEQHLGHNAMYWYKQSAEKPPELMFLYSVK
QLIRNETVPSRFIPECPDSSKLLLHVSAVDLEDSAVYFCASSRGLQDTQYFGPGTRLLVLEDLRNVTPPK
VSLFEPSKAEIANKQKATLVCLARGFFPDHVELSWWVNGKEVHSGVSTDPQAYKESNYSYCLSSRLRVSA
TFWHNPRNHFRCQVQFHGLSEEDKWPEGSPKPVTQNISAEAWGRADCGITSASYHQGVLSATILYEILLG
KATLYAVLVSGLVLMAMVKKKNS

TRTRRLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN BC055922
ORF Size 1130 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq BC055922
RefSeq Size 1133
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.