F11r (NM_172647) Mouse Tagged ORF Clone

CAT#: MG204187

F11r (GFP-tagged) - Mouse F11 receptor (F11r)

Change vector?

  • TrueORF®

USD 443


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name F11r (NM_172647) Mouse Tagged ORF Clone
Symbol F11r
Synonyms 9130004G24; AA638916; ESTM33; JAM; JAM-1; JAM-A; Jcam; Jcam1; Ly106
Vector pCMV6-AC-GFP
Sequence Data
ORF Nucleotide Sequence
>MG204187 representing NM_172647
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGCACCGAGGGGAAAGCCGGGAGGAAACTGTTGTTTCTCTTCACGTCTATGATCCTGGGCTCTTTGG
TACAAGGCAAGGGTTCGGTGTACACTGCTCAATCTGACGTCCAGGTTCCCGAGAACGAGTCCATCAAATT
GACCTGCACCTACTCTGGCTTCTCCTCTCCCCGAGTGGAGTGGAAGTTCGTCCAAGGCAGCACAACTGCA
CTTGTGTGTTATAACAGCCAGATCACAGCTCCCTATGCGGACCGAGTCACCTTCTCATCCAGTGGCATCA
CGTTCAGTTCTGTGACCCGGAAGGACAATGGAGAGTATACTTGCATGGTCTCCGAGGAAGGTGGCCAGAA
CTACGGGGAGGTCAGCATCCACCTCACTGTGCTTGTACCTCCATCCAAGCCGACGATCAGTGTCCCCTCC
TCTGTCACCATTGGGAACAGGGCAGTGCTGACCTGCTCAGAGCATGATGGTTCCCCACCCTCTGAATATT
CCTGGTTCAAGGACGGGATATCCATGCTTACAGCAGATGCCAAGAAAACCCGGGCCTTCATGAATTCTTC
ATTCACCATTGATCCAAAGTCGGGGGATCTGATCTTTGACCCCGTGACAGCCTTTGATAGTGGTGAATAC
TACTGCCAGGCCCAGAATGGGTATGGGACAGCCATGAGGTCAGAGGCTGCACACATGGATGCTGTGGAGC
TGAATGTGGGGGGCATCGTGGCAGCTGTCCTGGTAACACTGATTCTCCTTGGACTCTTGATTTTTGGCGT
CTGGTTTGCCTATAGCCGTGGATACTTTGAAAGAACAAAGAAAGGGACTGCACCGGGTAAGAAGGTCATT
TACAGCCAGCCCAGTACTCGAAGTGAGGGGGAATTCAAACAGACCTCGTCGTTCCTGGTG


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>MG204187 representing NM_172647
Red=Cloning site Green=Tags(s)

MGTEGKAGRKLLFLFTSMILGSLVQGKGSVYTAQSDVQVPENESIKLTCTYSGFSSPRVEWKFVQGSTTA
LVCYNSQITAPYADRVTFSSSGITFSSVTRKDNGEYTCMVSEEGGQNYGEVSIHLTVLVPPSKPTISVPS
SVTIGNRAVLTCSEHDGSPPSEYSWFKDGISMLTADAKKTRAFMNSSFTIDPKSGDLIFDPVTAFDSGEY
YCQAQNGYGTAMRSEAAHMDAVELNVGGIVAAVLVTLILLGLLIFGVWFAYSRGYFERTKKGTAPGKKVI
YSQPSTRSEGEFKQTSSFLV

TRTRRLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_172647
ORF Size 900 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_172647.2, NP_766235
RefSeq Size 2482
RefSeq ORF 903
Locus ID 16456
Cytogenetics 1 H3|1 79.43 cM
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.