Pcna (NM_011045) Mouse Tagged ORF Clone

CAT#: MG203392

  • TrueORF®

Pcna (tGFP-tagged) - Mouse proliferating cell nuclear antigen (Pcna)

ORF Plasmid: DDK tGFP

Lentiviral Particles: DDK w/ Puro mGFP w/ Puro

AAV Particle: DDK


  "NM_011045" in other vectors (4)

Reconstitution Protocol

USD 500.00

3 Weeks*

Size
    • 10 ug

Product Images

Frequently bought together (4)
pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
    • 10 ug

USD 750.00


Mouse monoclonal turboGFP antibody, clone OTI2H8
    • 100 ul

USD 412.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Other products for "Pcna"

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag TurboGFP
Symbol Pcna
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MG203392 representing NM_011045
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTTTGAGGCACGCCTGATCCAGGGCTCCATCCTGAAGAAGGTGCTGGAGGCTCTCAAAGACCTCATCA
ATGAGGCCTGCTGGGACGTCAGCTCGGGCGGCGTGAACCTGCAGAGCATGGACTCGTCTCACGTCTCCTT
GGTACAGCTTACTCTGCGCTCCGAAGGCTTCGACACATACCGCTGCGACCGCAACCTAGCCATGGGCGTG
AACCTCACCAGCATGTCCAAAATTCTAAAATGTGCTGGTAATGAAGACATCATTACATTAAGGGCTGAAG
ATAATGCAGACACCTTAGCACTAGTATTCGAAGCACCAAATCAAGAGAAAGTTTCAGACTATGAAATGAA
GTTAATGGACTTAGATGTGGAGCAACTTGGAATCCCAGAACAGGAGTACAGCTGTGTAATAAAGATGCCG
TCGGGTGAATTTGCACGTATATGCCGAGACCTTAGCCACATTGGAGATGCTGTTGTGATATCCTGTGCAA
AGAATGGGGTGAAGTTTTCTGCAAGTGGAGAGCTTGGCAATGGGAACATTAAGTTGTCACAAACAAGTAA
TGTGGATAAAGAAGAGGAGGCGGTAACCATAGAGATGAATGAGCCTGTTCACCTAACGTTTGCTCTGAGG
TACCTGAACTTTTTCACAAAAGCCACTCCACTGTCTCCTACAGTAACACTCAGTATGTCTGCAGATGTGC
CCCTTGTTGTAGAGTATAAAATTGCTGACATGGGACACTTAAAGTATTATTTGGCTCCCAAGATTGAAGA
TGAGGAAGCATCT


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>MG203392 representing NM_011045
Red=Cloning site Green=Tags(s)

MFEARLIQGSILKKVLEALKDLINEACWDVSSGGVNLQSMDSSHVSLVQLTLRSEGFDTYRCDRNLAMGV
NLTSMSKILKCAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMDLDVEQLGIPEQEYSCVIKMP
SGEFARICRDLSHIGDAVVISCAKNGVKFSASGELGNGNIKLSQTSNVDKEEEAVTIEMNEPVHLTFALR
YLNFFTKATPLSPTVTLSMSADVPLVVEYKIADMGHLKYYLAPKIEDEEAS

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_011045
ORF Size 783 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_011045.2, NP_035175.1
RefSeq Size 1260 bp
RefSeq ORF 786 bp
Locus ID 18538
UniProt ID P17918
Cytogenetics 2 64.15 cM
Gene Summary Auxiliary protein of DNA polymerase delta and is involved in the control of eukaryotic DNA replication by increasing the polymerase's processibility during elongation of the leading strand. Induces a robust stimulatory effect on the 3'-5' exonuclease and 3'-phosphodiesterase, but not apurinic-apyrimidinic (AP) endonuclease, APEX2 activities. Has to be loaded onto DNA in order to be able to stimulate APEX2. Plays a key role in DNA damage response (DDR) by being conveniently positioned at the replication fork to coordinate DNA replication with DNA repair and DNA damage tolerance pathways. Acts as a loading platform to recruit DDR proteins that allow completion of DNA replication after DNA damage and promote postreplication repair: Monoubiquitinated PCNA leads to recruitment of translesion (TLS) polymerases, while 'Lys-63'-linked polyubiquitination of PCNA is involved in error-free pathway and employs recombination mechanisms to synthesize across the lesion (By similarity).[UniProtKB/Swiss-Prot Function]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.