Nanos1 (BC056473) Mouse Tagged ORF Clone

CAT#: MG203137

Reviews ()
Write a review
  • TrueORF®

Nanos1 (GFP-tagged) - Mouse nanos homolog 1 (Drosophila) (cDNA clone MGC:67340 IMAGE:5702451)



Reconstitution Protocol

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 330.00


Availability*
3 Weeks

Size
    • 10 ug


Product images

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag TurboGFP
Symbol Nanos1
Synonyms nanos1
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MG203137 representing BC056473
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGCTCGTGCCCAGCGCCCGCTACGTGAGCGCCTCGGGCCCGGTGCACCCGCAGCCCTTCAGCTCCT
GGAACGACTACCTGGGGCTTGCCACGCTCATCACCAGGGCTAGCGACCGCGGCTCCCCGCATGAGGGGCC
CGGGCCCACGGCGGCGGGGCCCACGATGGGGCCGCCCGAGGACGATGAAGACGATGACGGCGAAGAGCCG
GAGGCCGGGGGCCGCTACCTGGGCGGTGCGTTGGAACTGCGCGCACTAGAGCTGTGTGCCGGCCCCGCTG
AGCCCGGGTTGCTGGAGGAGCGCTTCGCTGAGCTGAACCCGTTTGCAGGGCGCGCCGCCGCGGTTCTGCT
GGGCTGCGCGCCCACCGCCTCCACCACCGCCGCCGCCGCATCCACGGCCGAAGTGACGCCGCGCGAAGAG
CCAAGCCCTGCGTGGGCTGCCGAGCCTCGTCTGCACGCGGCTTCCGGGGCGACCGCCGCACGTCTGCTGA
AACCGGAGCTTCAGGTGTGTGTGTTTTGCCGGAACAACAAGGAGGCGGTGGCGCTCTACACCACACACAT
CCTCAAGGGCCCGGACGGCCGGGTGCTGTGCCCGGTCTTGCGCCGCTACACGTGCCCCCTGTGCGGCGCC
AGCGGCGACAACGCACATACCATCAAGTATTGCCCGCTCTCCAAAGTGCCACCGCCCACCGTCCGCCCGC
CGCCGCGCAGCAACAGGGACAGCCTGCCCAGCAAGAAGCTGCGC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>MG203137 representing BC056473
Red=Cloning site Green=Tags(s)

MALVPSARYVSASGPVHPQPFSSWNDYLGLATLITRASDRGSPHEGPGPTAAGPTMGPPEDDEDDDGEEP
EAGGRYLGGALELRALELCAGPAEPGLLEERFAELNPFAGRAAAVLLGCAPTASTTAAAASTAEVTPREE
PSPAWAAEPRLHAASGATAARLLKPELQVCVFCRNNKEAVALYTTHILKGPDGRVLCPVLRRYTCPLCGA
SGDNAHTIKYCPLSKVPPPTVRPPPRSNRDSLPSKKLR

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN BC056473
ORF Size 746 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq BC056473, AAH56473
RefSeq Size 3632 bp
RefSeq ORF 746 bp
Locus ID 332397
Cytogenetics 19 D3
Gene Summary This gene encodes a CCHC-type zinc finger protein that is a member of the nanos family. This protein co-localizes with the RNA-binding protein pumilio RNA-binding family member 2and may be involved in regulating translation as a post-transcriptional repressor. Mutations in a similar protein in human are associated with spermatogenic impairment. [provided by RefSeq, Sep 2015]
Other products for "Nanos1"
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.