OriGene Logo

Kctd6 (NM_027782) Mouse Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
MG202907
Kctd6 (tGFP-tagged) - Mouse potassium channel tetramerisation domain containing 6 (Kctd6)
Interest in protein/lysate? Submit request here!
ORF Plasmid:
tGFP DDK
AAV Particle:
DDK
  $500.00
3 Weeks*
Bulk Requests & Clone Modifications

Frequently Bought Together (4)

TA150041 Mouse monoclonal turboGFP antibody, clone OTI2H8
100 ul
$447.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100010 pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
10 ug
$780.00

Other products for "Kctd6 or NM_027782"

Specifications
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Kctd6
Synonyms 5430433B02Rik; AU044285
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MG202907 representing NM_027782
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGATAATGGGGACTGGGGCTATATGATGAGTGACCCAGTCACATTAAATGTAGGTGGACACTTGTACA
CGACATCGCTTACCACGTTGACACGCTACCCGGATTCTATGCTTGGAGCTATGTTTGGGGGTGACTTCCC
CACAGCCCGAGACCCTCAAGGCAATTACTTCATTGATCGAGACGGACCGCTCTTCCGCTATGTCCTTAAC
TTCCTACGGACTTCAGAACTGACACTCCCCCTGGACTTTAAGGAGTTTGATCTGCTTCGGAAAGAGGCTG
ATTTCTACCAGATCGAACCCTTGATTCAGTGTCTCAATGACCCCAGGCCTCTGTATCCTATGGATACTTT
TGAAGAAGTCGTAGAGCTGTCTAGCACTCGGAAGCTTTCTAAATATTCCAATCCGGTGGCCGTCATCATC
ACCCAGTTAACCATCACCACAAAGGTCCACTCCTTACTCGAAGGCATCTCAAACTATTTCACCAAGTGGA
ATAAGCACATGATGGACACCAGAGACTGCCAGGTCTCCTTCACCTTTGGACCGTGCGATTACCACCAGGA
AGTCTCTCTCCGGGTCCATCTGATGGAGTACATCACGAAGCAAGGTTTCACGATCCGCAATACTCGGGTG
CATCACATGAGCGAGCGGGCCAATGAGAACACAGTAGAGCACAACTGGACTTTCTGTAGACTGGCCCGCA
AGACGGACGAC

ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>MG202907 representing NM_027782
Red=Cloning site Green=Tags(s)

MDNGDWGYMMSDPVTLNVGGHLYTTSLTTLTRYPDSMLGAMFGGDFPTARDPQGNYFIDRDGPLFRYVLN
FLRTSELTLPLDFKEFDLLRKEADFYQIEPLIQCLNDPRPLYPMDTFEEVVELSSTRKLSKYSNPVAVII
TQLTITTKVHSLLEGISNYFTKWNKHMMDTRDCQVSFTFGPCDYHQEVSLRVHLMEYITKQGFTIRNTRV
HHMSERANENTVEHNWTFCRLARKTDD

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_027782
ORF Size 711 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_027782.3, NP_082058.1
RefSeq Size 1640 bp
RefSeq ORF 714 bp
Locus ID 71393
UniProt ID Q8BNL5
Cytogenetics 14 A1
Summary Probable substrate-specific adapter of a BCR (BTB-CUL3-RBX1) E3 ubiquitin-protein ligase complex mediating the ubiquitination and subsequent proteasomal degradation of target proteins. Promotes the ubiquitination of HDAC1; the function seems to depend on KCTD11:KCTD6 oligomerization. Can function as antagonist of the Hedgehog pathway by affecting the nuclear transfer of transcription factor GLI1; the function probably occurs via HDAC1 down-regulation, keeping GLI1 acetylated and inactive. Inhibits cell growth and tumorigenicity of medulloblastoma (MDB). Involved in regulating protein levels of ANK1 isoform Mu7 probably implicating CUL3-dependent proteasomal degradation.UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources
"NM_027782" in other vectors (4)
SKU Description Size Price
MC207706 Kctd6 (untagged) - Mouse potassium channel tetramerisation domain containing 6 (Kctd6), (10ug) 10 ug
$330.00
MR202907 Kctd6 (Myc-DDK-tagged) - Mouse potassium channel tetramerisation domain containing 6 (Kctd6) 10 ug
$289.00 $300.00
MR202907L3 Lenti ORF clone of Kctd6 (Myc-DDK-tagged) - Mouse potassium channel tetramerisation domain containing 6 (Kctd6) 10 ug
$600.00
MR202907L4 Lenti ORF clone of Kctd6 (mGFP-tagged) - Mouse potassium channel tetramerisation domain containing 6 (Kctd6) 10 ug
$600.00

Welcome to OriGene AI!

I'm your AI-powered guide to everything OriGene.
Ask me anything:

  • Product specs
  • Ordering help
  • Technical questions
  • How to find exactly what your experiment needs

Prefer a live agent? Connect with us by clicking the green chat icon, as seen in the image below or email our team at custsupport@origene.com.

Velaro Chat Img

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.