Cd79a (BC027633) Mouse Tagged ORF Clone

CAT#: MG202501

Cd79a (GFP-tagged) - Mouse CD79A antigen (immunoglobulin-associated alpha) (cDNA clone MGC:41188 IMAGE:1332396)

Clone Modification / Custom Cloning Service

  • TrueORF®

USD 351.00


Availability*
3 Weeks

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name Cd79a (BC027633) Mouse Tagged ORF Clone
Symbol Cd79a
Synonyms mb-1, Ig-alpha
Vector pCMV6-AC-GFP
Sequence Data
ORF Nucleotide Sequence
>MG202501 representing BC027633
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCCAGGGGGTCTAGAAGCCCTCAGAGCCCTGCCTCTCCTCCTCTTCTTGTCCTACGCCTGTTTGGGTC
CCGGATGCCAGGCCCTGCGGGTAGAAGGGGGTCCACCATCCCTGACGGTGAACTTGGGCGAGGAGGCCCG
CCTCACCTGTGAAAACAATGGCAGGAACCCTAATATCACATGGTGGTTCAGCCTTCAGTCTAACATCACA
TGGCCCCCAGTGCCACTGGGTCCTGGCCAGGGTACCACAGGCCAGCTGTTCTTCCCCGAAGTAAACAAGA
ACCACAGGGGCTTGTACTGGTGCCAAGTGATAGAAAACAACATATTAAAACGCTCCTGTGGTACTTACCT
CCGCGTGCGCAATCCAGTCCCTAGGCCCTTCCTGGACATGGGGGAAGGTACCAAGAACCGCATCATCACA
GCAGAAGGGATCATCTTGCTGTTCTGTGCAGTGGTGCCAGGGACGCTGCTGCTATTCAGGAAACGGTGGC
AAAATGAGAAGTTTGGGGTGGACATGCCAGATGACTATGAAGATGAAAATCTCTATGAGGGCCTGAACCT
TGATGACTGTTCTATGTATGAGGACATCTCCAGGGGACTCCAGGGCACCTACCAGGATGTGGGCAACCTC
CACATTGGAGATGCCCAGCTGGAAAAGCCA


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>MG202501 representing BC027633
Red=Cloning site Green=Tags(s)

MPGGLEALRALPLLLFLSYACLGPGCQALRVEGGPPSLTVNLGEEARLTCENNGRNPNITWWFSLQSNIT
WPPVPLGPGQGTTGQLFFPEVNKNHRGLYWCQVIENNILKRSCGTYLRVRNPVPRPFLDMGEGTKNRIIT
AEGIILLFCAVVPGTLLLFRKRWQNEKFGVDMPDDYEDENLYEGLNLDDCSMYEDISRGLQGTYQDVGNL
HIGDAQLEKP

TRTRRLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN BC027633
ORF Size 660 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq BC027633.1
RefSeq Size 1008
RefSeq ORF 662
Locus ID 12518
Cytogenetics 7 A3|7 13.49 cM
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)