OriGene Logo

Tmed10 (NM_026775) Mouse Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
MG202491
Tmed10 (tGFP-tagged) - Mouse transmembrane emp24-like trafficking protein 10 (yeast) (Tmed10)
Interest in protein/lysate? Submit request here!
ORF Plasmid:
tGFP DDK
AAV Particle:
DDK
  $500.00
3 Weeks*
Bulk Requests & Clone Modifications

Frequently Bought Together (4)

TA150041 Mouse monoclonal turboGFP antibody, clone OTI2H8
100 ul
$447.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100010 pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
10 ug
$780.00

Other products for "Tmed10 or NM_026775"

Specifications
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Tmed10
Synonyms 1110014C03Rik; p23; p24delta1; Tmp21
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MG202491 representing NM_026775
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCTGGTTTGTTTGGCCCACTCTCCCGGCCTGGCCCTCTCCCGTCCGCCTGGCTCTTTCTGTTGCTGC
TCGGCCCCAGCTCGGTCCTCGGCATCTCCTTCCATCTGCCCGTGAACTCTCGCAAGTGTCTCCGAGAGGA
GATCCACAAGGACCTGCTGGTGACGGGCGCCTACGAGATCACCGACCAGTCTGGGGGCGCTGGCGGCCTG
CGCACCCACCTCAAGATCACAGATTCTGCTGGCCATATTCTGTATGCCAAAGAGGATGCAACCAAGGGGA
AGTTTGCCTTTACCACGGAAGACTATGACATGTTTGAAGTGTGTTTTGAGAGCAAGGGAACAGGGCGGAT
ACCTGACCAACTCGTGATTCTAGACATGAAGCATGGAGTAGAGGCGAAAAATTATGAAGAGATTGCAAAA
GTCGAGAAACTCAAACCACTGGAGGTGGAGTTACGACGGCTCGAGGACCTTTCCGAGTCCATTGTTAATG
ACTTTGCCTACATGAAGAAGCGGGAAGAGGAGATGAGGGACACTAATGAGTCCACGAACACCCGGGTCCT
GTACTTCAGCATCTTTTCCATGTTCTGCCTCATTGGACTAGCCACCTGGCAGGTCTTCTACCTGCGTCGC
TTCTTCAAGGCCAAGAAGTTGATAGAG

ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>MG202491 representing NM_026775
Red=Cloning site Green=Tags(s)

MSGLFGPLSRPGPLPSAWLFLLLLGPSSVLGISFHLPVNSRKCLREEIHKDLLVTGAYEITDQSGGAGGL
RTHLKITDSAGHILYAKEDATKGKFAFTTEDYDMFEVCFESKGTGRIPDQLVILDMKHGVEAKNYEEIAK
VEKLKPLEVELRRLEDLSESIVNDFAYMKKREEEMRDTNESTNTRVLYFSIFSMFCLIGLATWQVFYLRR
FFKAKKLIE

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_026775
ORF Size 657 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_026775.4, NP_081051.1
RefSeq Size 3526 bp
RefSeq ORF 660 bp
Locus ID 68581
UniProt ID Q9D1D4
Cytogenetics 12 D2
Summary Involved in vesicular protein trafficking. Mainly functions in the early secretory pathway. Thought to act as cargo receptor at the lumenal side for incorporation of secretory cargo molecules into transport vesicles and to be involved in vesicle coat formation at the cytoplasmic side. In COPII vesicle-mediated anterograde transport involved in the transport of GPI-anchored proteins and proposed to act together with TMED2 as their cargo receptor; the function specifically implies SEC24C and SEC24D of the COPII vesicle coat and lipid raft-like microdomains of the ER. Recognizes GPI anchors structural remodeled in the ER by PGAP1 and MPPE1. In COPI vesicle-mediated retrograde transport involved in the biogenesis of COPI vesicles and vesicle coat recruitment. On Golgi membranes, acts as primary receptor for ARF1-GDP which is involved in COPI-vesicle formation. Increases coatomer-dependent GTPase-activating activity of ARFGAP2. Involved in trafficking of G protein-coupled receptors (GPCRs). Regulates F2LR1, OPRM1 and P2RY4 exocytic trafficking from the Golgi to the plasma membrane thus contributing to receptor resensitization. Involved in trafficking of amyloid beta A4 protein and soluble APP-beta release (independent of modulation of gamma-secretase activity). As part of the presenilin-dependent gamma-secretase complex regulates gamma-cleavages of the amyloid beta A4 protein to yield amyloid-beta 40 (Abeta40). Involved in organization of the Golgi apparatus (By similarity).UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources
"NM_026775" in other vectors (4)
SKU Description Size Price
MC202755 Tmed10 (untagged) - Mouse transmembrane emp24-like trafficking protein 10 (yeast) (Tmed10), (10ug) 10 ug
$300.00
MR202491 Tmed10 (Myc-DDK-tagged) - Mouse transmembrane emp24-like trafficking protein 10 (yeast) (Tmed10) 10 ug
$289.00 $300.00
MR202491L3 Lenti ORF clone of Tmed10 (Myc-DDK-tagged) - Mouse transmembrane emp24-like trafficking protein 10 (yeast) (Tmed10) 10 ug
$600.00
MR202491L4 Lenti ORF clone of Tmed10 (mGFP-tagged) - Mouse transmembrane emp24-like trafficking protein 10 (yeast) (Tmed10) 10 ug
$600.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.