Nudt16 (NM_029385) Mouse Tagged ORF Clone

  • TrueORF®
SKU
MG202315
Nudt16 (tGFP-tagged) - Mouse nudix (nucleoside diphosphate linked moiety X)-type motif 16 (Nudt16)
  $500.00
3 Weeks*
Specifications
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Nudt16
Synonyms 2310041H06Rik; 2810047L04Rik; 2900006H04Rik; AI851783
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MG202315 representing NM_029385
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGGGGCATCGGAAAGTGGAGCTCAGCGAGGCCCTGGCGCTCGGGCCGGACTGGCGCCACGCCTGCC
ATGCGCTGCTCTACGCGCCCGACCCCCGCAAGCTGTTCGGCCGCATCCCGATGCGCTTCGCCGTGCTGAT
GCAGATGCGCTTTGACGGGCGCCTGGGCTTCCCTGGCGGCTTCGTGGACGCGCAGGACAGCTGCCTGGAG
GACGGGCTGAACCGGGAACTGCGCGAGGAGCTGGGCGAAGCGATGTCTGCCTTCCGCGTTGAACGCTCTG
ACTACCGCAGCTCACACATCGCGGCCAGACCGCGCGTGGTGGCCCACTTCTATGCCAAGCGCCTGACTCT
GGAACAGCTGCAGGCTGTGGAAGCCAGGGCACCTCAAGCCAAGGACCATGGGCTGGAGGTGCTGGGCCTG
GTGCGGGTACCCCTGTACGTCCTCCGTGATGGTGAGGGAGGCCTGCCTGCCTTTCTGGAGAATTCCTTCA
TTGGAGCTGCCCGAGAGCAGCTACTAGAAGCCCTTCAGGACTTGAAACTTCTGGATCCTGGCATTATTGC
AAAACTAAAGATCCCAGATTCTAAG


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>MG202315 representing NM_029385
Red=Cloning site Green=Tags(s)

MEGHRKVELSEALALGPDWRHACHALLYAPDPRKLFGRIPMRFAVLMQMRFDGRLGFPGGFVDAQDSCLE
DGLNRELREELGEAMSAFRVERSDYRSSHIAARPRVVAHFYAKRLTLEQLQAVEARAPQAKDHGLEVLGL
VRVPLYVLRDGEGGLPAFLENSFIGAAREQLLEALQDLKLLDPGIIAKLKIPDSK

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_029385
ORF Size 585 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_029385.2, NP_083661.2
RefSeq Size 1606 bp
RefSeq ORF 588 bp
Locus ID 75686
UniProt ID Q6P3D0
Cytogenetics 9 F1
Summary RNA-binding and decapping enzyme that catalyzes the cleavage of the cap structure of snoRNAs and mRNAs in a metal-dependent manner. Part of the U8 snoRNP complex that is required for the accumulation of mature 5.8S and 28S rRNA. Has diphosphatase activity and removes m7G and/or m227G caps from U8 snoRNA and leaves a 5'monophosphate on the RNA. Catalyzes also the cleavage of the cap structure on mRNAs. Does not hydrolyze cap analog structures like 7-methylguanosine nucleoside triphosphate (m7GpppG). Also hydrolysis m7G- and m227G U3-capped RNAs but with less efficiencies. Has broad substrate specificity with manganese or cobalt as cofactor and can act on various RNA species. Binds to the U8 snoRNA; metal is not required for RNA-binding. May play a role in the regulation of snoRNAs and mRNAs degradation (By similarity). Acts also as a phosphatase; hydrolyzes the non-canonical purine nucleotides inosine diphosphate (IDP) and deoxyinosine diphosphate (dITP) as well as guanosine diphosphate (GDP), deoxyguanosine diphosphate (dGDP), xanthine diphosphate (XDP), inosine triphosphate (ITP) and deoxyinosine triphosphate (ITP) to their respective monophosphate derivatives and does not distinguish between the deoxy- and ribose forms. The order of activity with different substrates is IDP > dIDP >> GDP = dGDP > XDP = ITP = dITP. Binds strongly to GTP, ITP and XTP. Participates in the hydrolysis of dIDP/IDP and probably excludes non-canonical purines from RNA and DNA precursor pools, thus preventing their incorporation into RNA and DNA and avoiding chromosomal lesions.UniProtKB/Swiss-Prot Function
Reviews
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources
"NM_029385" in other vectors (4)
SKU Description Size Price
MC211684 Nudt16 (untagged) - Mouse nudix (nucleoside diphosphate linked moiety X)-type motif 16 (Nudt16), (10ug) 10 ug
$330.00
MR202315 Nudt16 (Myc-DDK-tagged) - Mouse nudix (nucleoside diphosphate linked moiety X)-type motif 16 (Nudt16) 10 ug
$289.00 $300.00
MR202315L3 Lenti ORF clone of Nudt16 (Myc-DDK-tagged) - Mouse nudix (nucleoside diphosphate linked moiety X)-type motif 16 (Nudt16) 10 ug
$600.00
MR202315L4 Lenti ORF clone of Nudt16 (mGFP-tagged) - Mouse nudix (nucleoside diphosphate linked moiety X)-type motif 16 (Nudt16) 10 ug
$600.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.