BC017643 (NM_144832) Mouse Tagged ORF Clone

CAT#: MG201751

BC017643 (GFP-tagged) - Mouse cDNA sequence BC017643 (BC017643)

Change vector?

  • TrueORF®

USD 443


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name BC017643 (NM_144832) Mouse Tagged ORF Clone
Symbol BC017643
Synonyms MGC28978; MGC37062; MGC37382
Vector pCMV6-AC-GFP
Sequence Data
ORF Nucleotide Sequence
>MG201751 representing NM_144832
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTATATGCAGGTGGAGACACGCACCAGCACCCGCCTCCATCTGAAGAGGGCTCCAGGCATCCGGTCTT
GGTCCCTGCTGGTCGGAATATTATCCACTGGCCTGGCTGCTGCCTATTACAGTGGAGATAGTCTGGGCTG
GAAGCTCTTCTATGTCACAGGCTGCCTATTTGTGGCTGTACAGAACTTGGAAGACTGGGAGGAGGCCATT
TTCAACAAGAACACTGGGAAGGTCATCTTAAAAACATTCAGCCTCTACAAGAAGCTGCTGACTCTTCTCA
GAGCGGGCCACGATCAAGTGGTGGTTCTGTTGAAAGACATCCAGGATGTGAATGTGGAGGAGGAAAAGGT
CCGTTACTTTGGGAAGGGCTACATGGTGGTGCTCCGGTTTGCAACAGGCTTCTCCCACCCTCTCACTCAG
AGTGCAGTCATGGGCCGACGCAGTGATGTGGAAGCCATTGCCAAACTCATCACTAGCTTCTTGGAGCTGC
ACCGCCTGGAGAGCCCCTCAGAACGGTCACAGAGCAGCGACAGTGAACCTGATGGCCCTGGTGGCCAGAG
T


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>MG201751 representing NM_144832
Red=Cloning site Green=Tags(s)

MYMQVETRTSTRLHLKRAPGIRSWSLLVGILSTGLAAAYYSGDSLGWKLFYVTGCLFVAVQNLEDWEEAI
FNKNTGKVILKTFSLYKKLLTLLRAGHDQVVVLLKDIQDVNVEEEKVRYFGKGYMVVLRFATGFSHPLTQ
SAVMGRRSDVEAIAKLITSFLELHRLESPSERSQSSDSEPDGPGGQS

TRTRRLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_144832
ORF Size 561 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_144832.1, NP_659081
RefSeq Size 2439
RefSeq ORF 564
Locus ID 217370
Cytogenetics 11|11 E2
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations