Arf6 (NM_007481) Mouse Tagged ORF Clone

CAT#: MG201520

Arf6 (GFP-tagged) - Mouse ADP-ribosylation factor 6 (Arf6)

Change vector?

  • TrueORF®

USD 443


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name Arf6 (NM_007481) Mouse Tagged ORF Clone
Symbol Arf6
Synonyms AI788669; AW496366
Vector pCMV6-AC-GFP
Sequence Data
ORF Nucleotide Sequence
>MG201520 representing NM_007481
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGGAAGGTGCTATCCAAGATCTTCGGGAACAAGGAAATGCGGATCCTCATGCTGGGCCTGGACGCAG
CCGGCAAGACAACGATCCTGTACAAGTTGAAGCTGGGCCAATCGGTGACCACCATCCCCACGGTGGGCTT
CAACGTGGAGACGGTGACTTACAAAAACGTCAAGTTCAACGTGTGGGATGTGGGCGGCCAGGACAAGATC
CGGCCGCTCTGGCGGCATTACTACACCGGGACCCAGGGTCTGATCTTCGTGGTAGACTGCGCCGACCGCG
ACCGCATCGACGAGGCCCGCCAGGAGCTGCACCGCATTATCAATGACCGGGAGATGAGGGACGCCATCAT
CCTCATCTTCGCCAACAAGCAGGACCTGCCCGATGCCATGAAACCCCATGAGATCCAGGAGAAACTGGGC
CTGACCCGGATTCGGGACAGGAACTGGTATGTGCAGCCCTCCTGTGCCACCTCCGGGGACGGACTCTATG
AGGGGCTCACATGGTTAACCTCTAACTACAAATCC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>MG201520 representing NM_007481
Red=Cloning site Green=Tags(s)

MGKVLSKIFGNKEMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKI
RPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLG
LTRIRDRNWYVQPSCATSGDGLYEGLTWLTSNYKS

TRTRRLE - GFP Tag - V
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_007481
ORF Size 525 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_007481.2, NP_031507
RefSeq Size 3740
RefSeq ORF 528
Locus ID 11845
Cytogenetics 12|12 C2
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations