OriGene Logo

Phca (BC023924) Mouse Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
MG201511
Phca (tGFP-tagged) - Mouse phytoceramidase, alkaline (cDNA clone MGC:36600 IMAGE:5324078)
Interest in protein/lysate? Submit request here!
ORF Plasmid:
tGFP DDK
AAV Particle:
DDK
  $500.00
3 Weeks*
Bulk Requests & Clone Modifications

Frequently Bought Together (4)

TA150041 Mouse monoclonal turboGFP antibody, clone OTI2H8
100 ul
$447.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100010 pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
10 ug
$780.00

Other products for "Phca or BC023924"

Specifications
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Phca
Synonyms 1110057L18Rik; 5430429L08Rik; AV015045; Phca
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MG201511 representing BC023924
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTCCGGCTGTGGACCGCAAAGGCTATTGGGGCCCCACGACCTCCACATTGGACTGGTGTGAGGAGA
ACTATGTGGTGACCTTGTTCGTCGCTGAGTTCTGGAATACAGTGAGTAACCTGATTATGATCATACCTCC
AATTTTTGGTGCAATTCAAGGCATTAGAGACAGACTGGAGAAGCGGTACATTGCTGCTTACTTAGCACTC
ACAGTGGTAGGAATGGGATCCTGGTGTTTCCACATGACTCTGAAATATGAAATGCAGCTGTTGGATGAGC
TCCCCATGATTTACAGCTGCTGCATATTTGTATACTGCATGTTTGAGTGTTTCAAGACAAAGAGCTCAAT
AAACTACCATCTTCTTTTTACCCTATTTCTATACAGTTTAACAGTAACTACGATTTACCTAAAAGTCAAA
GAACCTATATTCCATCAGGTCATGTATGGAATGTTGGTCTTTACATTAGTACTTCGTTCTATTTATATTG
TTACATGTGTATCTCCAGAGTCTTGTCTGTAC

ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>MG201511 representing BC023924
Red=Cloning site Green=Tags(s)

MAPAVDRKGYWGPTTSTLDWCEENYVVTLFVAEFWNTVSNLIMIIPPIFGAIQGIRDRLEKRYIAAYLAL
TVVGMGSWCFHMTLKYEMQLLDELPMIYSCCIFVYCMFECFKTKSSINYHLLFTLFLYSLTVTTIYLKVK
EPIFHQVMYGMLVFTLVLRSIYIVTCVSPESCLY

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN BC023924
ORF Size 522 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq BC023924, AAH23924
RefSeq Size 1460 bp
RefSeq ORF 524 bp
Locus ID 66190
Cytogenetics 7 E1
Summary Endoplasmic reticulum and Golgi ceramidase that catalyzes the hydrolysis of unsaturated long-chain C18:1-, C20:1- and C20:4-ceramides, dihydroceramides and phytoceramides into sphingoid bases like sphingosine and free fatty acids at alkaline pH (PubMed:26474409). Ceramides, sphingosine, and its phosphorylated form sphingosine-1-phosphate are bioactive lipids that mediate cellular signaling pathways regulating several biological processes including cell proliferation, apoptosis and differentiation (PubMed:26474409). Controls the generation of sphingosine in erythrocytes, and thereby sphingosine-1-phosphate in plasma (By similarity). Through the regulation of ceramides and sphingosine-1-phosphate homeostasis in the brain may play a role in neurons survival and function (PubMed:26474409). By regulating the levels of proinflammatory ceramides in immune cells and tissues, may modulate the inflammatory response (PubMed:26938296).UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources
"BC023924" in other vectors (4)
SKU Description Size Price
MC206896 Phca (untagged) - Mouse phytoceramidase, alkaline (cDNA clone MGC:36600 IMAGE:5324078), (10ug) 10 ug
$330.00
MR201511 Phca (Myc-DDK-tagged) - Mouse phytoceramidase, alkaline (cDNA clone MGC:36600 IMAGE:5324078) 10 ug
$289.00 $300.00
MR201511L3 Lenti ORF clone of Phca (Myc-DDK-tagged) - Mouse phytoceramidase, alkaline (cDNA clone MGC:36600 IMAGE:5324078) 10 ug
$600.00
MR201511L4 Lenti ORF clone of Phca (mGFP-tagged) - Mouse phytoceramidase, alkaline (cDNA clone MGC:36600 IMAGE:5324078) 10 ug
$600.00

Welcome to OriGene AI!

I'm your AI-powered guide to everything OriGene.
Ask me anything:

  • Product specs
  • Ordering help
  • Technical questions
  • How to find exactly what your experiment needs

Prefer a live agent? Connect with us by clicking the green chat icon, as seen in the image below or email our team at custsupport@origene.com.

Velaro Chat Img

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.