OriGene Logo

Nhp2 (NM_026631) Mouse Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
MG201118
Nhp2 (tGFP-tagged) - Mouse nucleolar protein family A, member 2 (Nola2)
Interest in protein/lysate? Submit request here!
ORF Plasmid:
tGFP DDK
AAV Particle:
DDK
  $350.00
3 Weeks*
Bulk Requests & Clone Modifications

Frequently Bought Together (4)

TA150041 Mouse monoclonal turboGFP antibody, clone OTI2H8
100 ul
$447.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100010 pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
10 ug
$780.00

Other products for "Nhp2 or NM_026631"

Specifications
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Nhp2
Synonyms 2410130M07Rik; D11Ertd175e; Nola2
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MG201118 representing NM_026631
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGACCAAAGTAAAGGCCGCTCCCGAAGAGTCCGAGGCGCAGGCGGAGGGCTGCAGCGAGGAGCGCACGT
ACAAAGAGCTGCTGGTCAATCTGAACCCCATCGCGCAGCCCCTGGCTTCCCGCCGCCTGACGCGCAAGCT
CTACAAGTGCATCAAGAAGGCTGTGAAGCAGAAGCAGATTCGTCGCGGGGTGAAGGAGGTTCAGAAATTT
GTCAACAAGGGCGAGAAAGGGATCATGGTTTTGGCAGGAGATACATTGCCGATTGAGGTGTACTGCCATC
TTCCAGTTCTGTGCGAGGACCAGAACTTGCCCTACGTCTACATCCCCTCTAAGACGGACTTGGGTGCAGC
CACAGGCTCCAAGCGTCCCACTTGTGTGATCATGGTGAAGCCCCATGAAGAATATCAGGAGACCTACGAC
AAGTGCCTGGAGGAGGTGCAGGCACTGCCTACACCTCTG

ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>MG201118 representing NM_026631
Red=Cloning site Green=Tags(s)

MTKVKAAPEESEAQAEGCSEERTYKELLVNLNPIAQPLASRRLTRKLYKCIKKAVKQKQIRRGVKEVQKF
VNKGEKGIMVLAGDTLPIEVYCHLPVLCEDQNLPYVYIPSKTDLGAATGSKRPTCVIMVKPHEEYQETYD
KCLEEVQALPTPL

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_026631
ORF Size 459 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_026631.4
RefSeq Size 1005 bp
RefSeq ORF 462 bp
Locus ID 52530
UniProt ID Q9CRB2
Cytogenetics 11 31.14 cM
Summary Required for ribosome biogenesis and telomere maintenance. Part of the H/ACA small nucleolar ribonucleoprotein (H/ACA snoRNP) complex, which catalyzes pseudouridylation of rRNA. This involves the isomerization of uridine such that the ribose is subsequently attached to C5, instead of the normal N1. Each rRNA can contain up to 100 pseudouridine ("psi") residues, which may serve to stabilize the conformation of rRNAs. May also be required for correct processing or intranuclear trafficking of TERC, the RNA component of the telomerase reverse transcriptase (TERT) holoenzyme (By similarity).UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources
"NM_026631" in other vectors (4)
SKU Description Size Price
MC204573 Nhp2 (untagged) - Mouse NHP2 ribonucleoprotein homolog (yeast) (Nhp2), (10ug) 10 ug
$150.00
MR201118 Nhp2 (Myc-DDK-tagged) - Mouse NHP2 ribonucleoprotein homolog (yeast) (Nhp2) 10 ug
$289.00
MR201118L3 Lenti ORF clone of Nhp2 (Myc-DDK-tagged) - Mouse NHP2 ribonucleoprotein homolog (yeast) (Nhp2) 10 ug
$450.00
MR201118L4 Lenti ORF clone of Nhp2 (mGFP-tagged) - Mouse NHP2 ribonucleoprotein homolog (yeast) (Nhp2) 10 ug
$450.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.