Ube2n (NM_080560) Mouse Tagged ORF Clone

CAT#: MG201097

Ube2n (tGFP-tagged) - Mouse ubiquitin-conjugating enzyme E2N (Ube2n)

Product Images

Circular map for MG201097

Specifications

Product Data

• Type: Mouse Tagged ORF Clone
• Tag: TurboGFP
• Symbol: Ube2n
• Synonyms: 1500026J17Rik; AL022654; BB101821; UBC13
• Vector: pCMV6-AC-GFP
• E. coli Selection: Ampicillin (100 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >MG201097 representing NM_080560
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGGCCGGGCTGCCCCGCAGGATCATCAAGGAAACCCAGCGTTTGCTGGCAGAACCAGTTCCTGGCATTA
  AAGCAGAACCAGATGAGAGCAACGCCCGTTATTTTCATGTGGTCATTGCTGGCCCCCAGGATTCCCCCTT
  TGAGGGAGGGACTTTTAAACTTGAACTATTCCTTCCAGAAGAATACCCAATGGCAGCACCTAAAGTACGT
  TTCATGACCAAAATTTATCATCCTAATGTAGACAAGTTGGGAAGAATATGTTTAGATATTTTGAAAGATA
  AGTGGTCCCCAGCACTGCAGATCCGCACAGTTCTGCTATCAATCCAGGCTTTGTTAAGTGCTCCTAATCC
  AGATGATCCATTAGCAAATGATGTAGCCGAGCAATGGAAGACCAACGAAGCCCAAGCCATAGAAACAGCG
  AGAGCATGGACTAGGCTATATGCCATGAACAATATT
  
  ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
  Protein Sequence

  >MG201097 representing NM_080560
  Red=Cloning site Green=Tags(s)
  
  MAGLPRRIIKETQRLLAEPVPGIKAEPDESNARYFHVVIAGPQDSPFEGGTFKLELFLPEEYPMAAPKVR
  FMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLANDVAEQWKTNEAQAIETA
  RAWTRLYAMNNI
  
  TRTRPLE - GFP Tag - V
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_080560
• ORF Size: 456 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_080560.3, NP_542127.1
• RefSeq Size: 3851 bp
• RefSeq ORF: 459 bp
• Locus ID: 93765
• UniProt ID: P61089
• Cytogenetics: 10 C2
• Gene Summary: The UBE2V1-UBE2N and UBE2V2-UBE2N heterodimers catalyze the synthesis of non-canonical 'Lys-63'-linked polyubiquitin chains (PubMed:22424771, PubMed:28039360). This type of polyubiquitination does not lead to protein degradation by the proteasome. Mediates transcriptional activation of target genes. Plays a role in the control of progress through the cell cycle and differentiation. Plays a role in the error-free DNA repair pathway and contributes to the survival of cells after DNA damage. Acts together with the E3 ligases, HLTF and SHPRH, in the 'Lys-63'-linked poly-ubiquitination of PCNA upon genotoxic stress, which is required for DNA repair. Appears to act together with E3 ligase RNF5 in the 'Lys-63'-linked polyubiquitination of JKAMP thereby regulating JKAMP function by decreasing its association with components of the proteasome and ERAD. Promotes TRIM5 capsid-specific restriction activity and the UBE2V1-UBE2N heterodimer acts in concert with TRIM5 to generate 'Lys-63'-linked polyubiquitin chains which activate the MAP3K7/TAK1 complex which in turn results in the induction and expression of NF-kappa-B and MAPK-responsive inflammatory genes.[UniProtKB/Swiss-Prot Function]