OriGene Logo

N6amt1 (BC098330) Mouse Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
MG201062
N6amt1 (tGFP-tagged) - Mouse N-6 adenine-specific DNA methyltransferase 1 (putative) (cDNA clone MGC:106447 IMAGE:30548526), complete
Interest in protein/lysate? Submit request here!
ORF Plasmid:
tGFP DDK
AAV Particle:
DDK
  $350.00
3 Weeks*
Bulk Requests & Clone Modifications

Frequently Bought Together (4)

TA150041 Mouse monoclonal turboGFP antibody, clone OTI2H8
100 ul
$447.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100010 pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
10 ug
$780.00

Other products for "N6amt1 or BC098330"

Specifications
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol N6amt1
Synonyms 5830445C04Rik; Hemk2; Pred28
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MG201062 representing BC098330
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGGCGCCGAGTGTCCCCACGCCGTTGTACGGGCACGTGGGTCGCGGAGCCTTCCGCGACGTGTACG
AGCCAGCGGAGGACACGTTCCTGTTACTGGACGCGCTCGAGGCGGCGGCGGCCGAGCTAGCAGGAGTGGA
AATATGCCTTGAAGTAGGAGCAGGATCTGGTGTGGTGTCTGCATTCCTGGCCTCCATGATAGGTCCTCGG
GCCTTATACATGTACACTGATATCAACCCTGAGGCAGCCGCATGTACCTTGGAAACAGCACGCTGTAACA
GAGTCCATGTTCAGCCAGTGATCACAGATTTGGTGCACGGCTTGCTGCCCAGACTGAAGGGGAAAGTAGA
CCTGCTGGTGTTTAACCCCCCCTATGTAGTGACTCCGCCTGAAGAGGTAAGACTCACAACAGAACTCAGT
CTTTGTTCCCAGCTGTTTCACGAGACCAAG

ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>MG201062 representing BC098330
Red=Cloning site Green=Tags(s)

MAAPSVPTPLYGHVGRGAFRDVYEPAEDTFLLLDALEAAAAELAGVEICLEVGAGSGVVSAFLASMIGPR
ALYMYTDINPEAAACTLETARCNRVHVQPVITDLVHGLLPRLKGKVDLLVFNPPYVVTPPEEVRLTTELS
LCSQLFHETK

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN BC098330
ORF Size 450 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq BC098330, AAH98330
RefSeq Size 3489 bp
RefSeq ORF 452 bp
Locus ID 67768
Cytogenetics 16 C3.3
Summary Methyltransferase that can methylate both proteins and DNA, and to a lower extent, arsenic (PubMed:20606008, PubMed:26797129). Catalytic subunit of a heterodimer with TRMT112, which catalyzes N5-methylation of Glu residue of proteins with a Gly-Gln-Xaa-Xaa-Xaa-Arg motif (PubMed:26797129). Methylates ETF1 on 'Gln-185'; ETF1 needs to be complexed to ERF3 in its GTP-bound form to be efficiently methylated (PubMed:20606008, PubMed:26797129). Also acts as a N(6)-adenine-specific DNA methyltransferase by mediating methylation of DNA on the 6th position of adenine (N(6)-methyladenosine) (By similarity). N(6)-methyladenosine (m6A) DNA is significantly enriched in exonic regions and is associated with gene transcriptional activation (By similarity). May also play a role in the modulation of arsenic-induced toxicity by mediating the conversion of monomethylarsonous acid (3+) into the less toxic dimethylarsonic acid (By similarity). It however only plays a limited role in arsenic metabolism compared with AS3MT (By similarity).UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources
"BC098330" in other vectors (4)
SKU Description Size Price
MC206917 N6amt1 (untagged) - Mouse N-6 adenine-specific DNA methyltransferase 1 (putative) (cDNA clone MGC:106447 IMAGE:30548526), complete, (10ug) 10 ug
$165.00
MR201062 N6amt1 (Myc-DDK-tagged) - Mouse N-6 adenine-specific DNA methyltransferase 1 (putative) (cDNA clone MGC:106447 IMAGE:30548526), complete 10 ug
$289.00
MR201062L3 Lenti ORF clone of N6amt1 (Myc-DDK-tagged) - Mouse N-6 adenine-specific DNA methyltransferase 1 (putative) (cDNA clone MGC:106447 IMAGE:30548526), complete 10 ug
$450.00
MR201062L4 Lenti ORF clone of N6amt1 (mGFP-tagged) - Mouse N-6 adenine-specific DNA methyltransferase 1 (putative) (cDNA clone MGC:106447 IMAGE:30548526), complete 10 ug
$450.00

Welcome to OriGene AI!

I'm your AI-powered guide to everything OriGene.
Ask me anything:

  • Product specs
  • Ordering help
  • Technical questions
  • How to find exactly what your experiment needs

Prefer a live agent? Connect with us by clicking the green chat icon, as seen in the image below or email our team at custsupport@origene.com.

Velaro Chat Img

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.