Npc2 (NM_023409) Mouse Tagged ORF Clone

CAT#: MG201050

Npc2 (tGFP-tagged) - Mouse Niemann Pick type C2 (Npc2)

Product Images

Circular map for MG201050

Specifications

Product Data

• Type: Mouse Tagged ORF Clone
• Tag: TurboGFP
• Symbol: Npc2
• Synonyms: 2700012J19Rik; AA408070; AU045843; HE1
• Vector: pCMV6-AC-GFP
• E. coli Selection: Ampicillin (100 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >MG201050 representing NM_023409
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGCGTTTTCTGGCCGCCACGATCCTGCTGCTGGCGCTGGTCGCTGCCAGCCAGGCGGAGCCCCTGCACT
  TCAAGGACTGCGGCTCTAAGGTGGGAGTTATAAAGGAGGTGAATGTGAGCCCATGTCCCACCGATCCCTG
  TCAGCTGCACAAAGGCCAGTCCTACAGTGTCAACATCACCTTTACCAGCGGCACTCAGTCCCAGAACAGC
  ACGGCCTTGGTCCACGGCATCCTGGAAGGGATCCGGGTCCCCTTCCCTATTCCTGAGCCTGACGGTTGTA
  AGAGTGGAATCAACTGCCCCATCCAGAAAGACAAGGTCTACAGCTACCTGAATAAGCTTCCGGTGAAGAA
  TGAATACCCCTCTATAAAACTGGTGGTGGAATGGAAACTTGAAGATGACAAAAAGAATAATCTCTTCTGC
  TGGGAGATCCCAGTTCAGATCACAAGC
  
  ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
  Protein Sequence

  >MG201050 representing NM_023409
  Red=Cloning site Green=Tags(s)
  
  MRFLAATILLLALVAASQAEPLHFKDCGSKVGVIKEVNVSPCPTDPCQLHKGQSYSVNITFTSGTQSQNS
  TALVHGILEGIRVPFPIPEPDGCKSGINCPIQKDKVYSYLNKLPVKNEYPSIKLVVEWKLEDDKKNNLFC
  WEIPVQITS
  
  TRTRPLE - GFP Tag - V
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_023409
• ORF Size: 447 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_023409.4, NP_075898.1
• RefSeq Size: 3278 bp
• RefSeq ORF: 450 bp
• Locus ID: 67963
• UniProt ID: Q9Z0J0
• Cytogenetics: 12 D1
• Gene Summary: Intracellular cholesterol transporter which acts in concert with NPC1 and plays an important role in the egress of cholesterol from the lysosomal compartment (PubMed:12591949, PubMed:17018531, PubMed:21315718, PubMed:26296895). Unesterified cholesterol that has been released from LDLs in the lumen of the late endosomes/lysosomes is transferred by NPC2 to the cholesterol-binding pocket in the N-terminal domain of NPC1. May bind and mobilize cholesterol that is associated with membranes. NPC2 binds cholesterol with a 1:1 stoichiometry. Can bind a variety of sterols, including lathosterol, desmosterol and the plant sterols stigmasterol and beta-sitosterol (By similarity). The secreted form of NCP2 regulates biliary cholesterol secretion via stimulation of ABCG5/ABCG8-mediated cholesterol transport (PubMed:21315718).[UniProtKB/Swiss-Prot Function]