Ap4s1 (NM_021710) Mouse Tagged ORF Clone

  • TrueORF®
SKU
MG200941
Ap4s1 (tGFP-tagged) - Mouse adaptor-related protein complex AP-4, sigma 1 (Ap4s1)
  $350.00
3 Weeks*
Specifications
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Ap4s1
Synonyms AI314282
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MG200941 representing NM_021710
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGATCAAGTTTTTCCTTATGGTGAACAAGCAAGGGCAGACCCGACTGTCTAAGTACTACGAGCATGTGG
ACATTAATAAACGTGCGCTTCTGGAGACTGAGGTCAGCAAGAGTTGCCTGTCTCGGTCCAGCGAACAATG
CTCATTCATTGAATACAAGGATTTTAAACTGATCTACCGGCAATATGCAGCTCTCTTTGTTGTGGTTGGA
GTTAATGACACTGAGAATGAGATGGCTATCTATGAATTTATACACAATTTTGTGGAAGTTTTAGATGGGT
ACTTCAGCCGAGTGAGTGAATTAGATATAATGTTTAATTTGGATAAAGTTCACATCATTTTGGATGAGAT
GGTGTTAAATGGCTGCATTGTGGAAACTAACAGAGCCAGAATTCTTGCCCCTCTGCTGATTCTTGACAAG
CTGTCGGAAAGC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>MG200941 representing NM_021710
Red=Cloning site Green=Tags(s)

MIKFFLMVNKQGQTRLSKYYEHVDINKRALLETEVSKSCLSRSSEQCSFIEYKDFKLIYRQYAALFVVVG
VNDTENEMAIYEFIHNFVEVLDGYFSRVSELDIMFNLDKVHIILDEMVLNGCIVETNRARILAPLLILDK
LSES

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_021710
ORF Size 432 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_021710.4
RefSeq Size 1034 bp
RefSeq ORF 435 bp
Locus ID 11782
UniProt ID Q9WVL1
Cytogenetics 12 B3
Summary This gene encodes the sigma subunit of the adaptor-related protein complex 4 which mediates intracellular membrane trafficking along the endocytic and secretory transport pathways. This complex contains four subunits, beta, epsilon, mu, and sigma, and belongs to a family of five adapter protein complexes, including three clathrin-associated complexes and two non clathrin-associated complexes, that localize to different intracellular compartments and mediate membrane vesicle trafficking using distinct pathways. In humans, loss-of-function mutations in this gene have been linked to specific adapter complex 4 deficiency disorders including hereditary spastic paraplegia. Alternate splicing results in multiple transcript variants. provided by RefSeq, Jul 2016
Reviews
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources
"NM_021710" in other vectors (4)
SKU Description Size Price
MC205886 Ap4s1 (untagged) - Mouse adaptor-related protein complex AP-4, sigma 1 (Ap4s1), (10ug) 10 ug
$150.00
MR200941 Ap4s1 (Myc-DDK-tagged) - Mouse adaptor-related protein complex AP-4, sigma 1 (Ap4s1) 10 ug
$289.00
MR200941L3 Lenti ORF clone of Ap4s1 (Myc-DDK-tagged) - Mouse adaptor-related protein complex AP-4, sigma 1 (Ap4s1) 10 ug
$450.00
MR200941L4 Lenti ORF clone of Ap4s1 (mGFP-tagged) - Mouse adaptor-related protein complex AP-4, sigma 1 (Ap4s1) 10 ug
$450.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.