Lypd1 (BC058599) Mouse Tagged ORF Clone

CAT#: MG200904

Lypd1 (GFP-tagged) - Mouse Ly6/Plaur domain containing 1 (cDNA clone MGC:67654 IMAGE:6313510)

Clone Modification / Custom Cloning Service

  • TrueORF®

USD 443.00


Availability*
3 Weeks

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name Lypd1 (BC058599) Mouse Tagged ORF Clone
Symbol Lypd1
Synonyms Lypdc1, Lynx2
Vector pCMV6-AC-GFP
Sequence Data
>MG200904 representing BC058599
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTGGGTTCTCGGCATCGCAGCAACTTTTTGCGGATTGTTCTGGCTTCCAGGGCTGGCGCTGCAAATTC
AGTGCTACCAGTGTGAAGAATTCCAGCTGAACAACGATTGCTCATCCCCTGAGTTCATCGTAAATTGCAC
CGTGAACGTTCAAGACATGTGTCAGAAAGAAGTGATGGAGCAAAGTGCTGGGATCATGTACCGGAAGTCG
TGTGCATCGTCAGCAGCCTGTCTCATTGCTTCAGCTGGGTACCAGTCCTTCTGTTCCCCTGGGAAACTGA
ACTCCGTGTGCATCAGCTGCTGCAACACCCCTCTTTGCAATGGGCCGAGGCCCAAGAAGAGAGGCAGCTC
TGCCTCGGCCATCAGGCCAGGGCTTCTCACCACTCTCCTGTTCTTCCACTTAGCCCTCTGCTTGGCACAC
TGC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>MG200904 representing BC058599
Red=Cloning site Green=Tags(s)

MWVLGIAATFCGLFWLPGLALQIQCYQCEEFQLNNDCSSPEFIVNCTVNVQDMCQKEVMEQSAGIMYRKS
CASSAACLIASAGYQSFCSPGKLNSVCISCCNTPLCNGPRPKKRGSSASAIRPGLLTTLLFFHLALCLAH
C

TRTRRLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN BC058599
ORF Size 425 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq BC058599
RefSeq Size 1800
RefSeq ORF 425
Locus ID 72585
Cytogenetics 1|1 E3
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.