Tmem234 (NM_029748) Mouse Tagged ORF Clone

CAT#: MG200897

Tmem234 (GFP-tagged) - Mouse RIKEN cDNA 2510006D16 gene (2510006D16Rik)

Clone Modification / Custom Cloning Service

  • TrueORF®

USD 443.00


Availability*
3 Weeks

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name Tmem234 (NM_029748) Mouse Tagged ORF Clone
Symbol Tmem234
Synonyms 1500002D11Rik; 2510006D16Rik; 4933407D05Rik
Vector pCMV6-AC-GFP
Sequence Data
ORF Nucleotide Sequence
>MG200897 representing NM_029748
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGGCGTCCTGGGGGCAGGTGCTTGCTCTGGTGCTGGTGGCCGCACTGTGGGGTGGCACGCAGCCGC
TGCTGAAGCGAGCCTCCTCCGGCCTGGAGCAAGTGCGTGAGCGGACGTGGGCCTGGCAGCTGTTGCAGGA
GATAAAGGCTCTCTTCGGGAATACTGAGTACCTGATGCCCTTTCTCCTCAATCAGAGTGGATCCCTTCTC
TACTACTTGACTTTGGCATCAACAGATCTGACGTTAGCTGTGCCCATCTGCAACTCTCTGGCCATCGTCT
TTACACTGATTGTTGGGAAGGTCCTTGGAGAAGATATTGGTGGGAAAGAAGCAGTGGCTGGCATGGTGCT
CACCATCACAGGGATCACCGTGTGCATCACAAGCTCGGTGAGCAAGACCCAGGGCCAACCGTCGCACTCC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>MG200897 representing NM_029748
Red=Cloning site Green=Tags(s)

MAASWGQVLALVLVAALWGGTQPLLKRASSGLEQVRERTWAWQLLQEIKALFGNTEYLMPFLLNQSGSLL
YYLTLASTDLTLAVPICNSLAIVFTLIVGKVLGEDIGGKEAVAGMVLTITGITVCITSSVSKTQGQPSHS

TRTRRLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_029748
ORF Size 420 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_029748.1, NP_084024
RefSeq Size 773
RefSeq ORF 423
Locus ID 76799
Cytogenetics 4|4 D2.2
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.