Pnrc2 (NM_026383) Mouse Tagged ORF Clone

CAT#: MG200889

Pnrc2 (tGFP-tagged) - Mouse proline-rich nuclear receptor coactivator 2 (Pnrc2)

Product Images

Circular map for MG200889

Specifications

Product Data

• Type: Mouse Tagged ORF Clone
• Tag: TurboGFP
• Symbol: Pnrc2
• Synonyms: 0610011E17Rik; D4Bwg0593e
• Vector: pCMV6-AC-GFP
• E. coli Selection: Ampicillin (100 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >MG200889 representing NM_026383
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGGGTGGCGGAGAGAGGTATAACATTCCAGACCCTCAATCTAGAAATGCTAGTAAGAACCAAGAACAGC
  AAAATAGACAGAAGAGCAAGGATCAGAATTCTTCCCAGACGAAGATTGCTCATAAGAAAAAGGAACGAGG
  ACATGGGTACAATCCAGCAGCAGCAGCATGGCAGGCCATGCAAAATGGGGGAAAGACCAAGAGCCTTTCT
  AACAACTCCAACTGGAATGCTGGTTTATCAAGTCCTAGCTTGCTTTTTAAGTCTCAAGCTAGTCAGAACT
  ATGCTGGAGCCAAATTTAGTGAACCACCATCACCAAGTGTTCTCCCCAAGCCACCAAGCCACTGGGTTCA
  TGTTTCCTTGAACCCTTCAGATAAGGAAACGATGACATTTCAACTTAAAACCTTACTTAAGGTACAGGTA
  
  ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
  Protein Sequence

  >MG200889 representing NM_026383
  Red=Cloning site Green=Tags(s)
  
  MGGGERYNIPDPQSRNASKNQEQQNRQKSKDQNSSQTKIAHKKKERGHGYNPAAAAWQAMQNGGKTKSLS
  NNSNWNAGLSSPSLLFKSQASQNYAGAKFSEPPSPSVLPKPPSHWVHVSLNPSDKETMTFQLKTLLKVQV
  
  TRTRPLE - GFP Tag - V
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_026383
• ORF Size: 420 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_026383.3
• RefSeq Size: 1889 bp
• RefSeq ORF: 423 bp
• Locus ID: 52830
• UniProt ID: Q9CR73
• Cytogenetics: 4 68.01 cM
• Gene Summary: Involved in nonsense-mediated mRNA decay (NMD) by acting as a bridge between the mRNA decapping complex and the NMD machinery (By similarity). May act by targeting the NMD machinery to the P-body and recruiting the decapping machinery to aberrant mRNAs (By similarity). Required for UPF1/RENT1 localization to the P-body (By similarity). Plays a role in glucocorticoid receptor-mediated mRNA degradation by interacting with the glucocorticoid receptor NR3C1 in a ligand-dependent manner when it is bound to the 5' UTR of target mRNAs and recruiting the RNA helicase UPF1 and the mRNA-decapping enzyme DCP1A, leading to RNA decay (By similarity). Also acts as a nuclear receptor coactivator. May play a role in controlling the energy balance between energy storage and energy expenditure (PubMed:17971453).[UniProtKB/Swiss-Prot Function]