Atg12 (NM_026217) Mouse Tagged ORF Clone

CAT#: MG200886

  • TrueORF®

Atg12 (tGFP-tagged) - Mouse autophagy-related 12 (yeast) (Atg12)



  "NM_026217" in other vectors (4)

Reconstitution Protocol

USD 350.00

3 Weeks*

Size
    • 10 ug

Product Images

Frequently bought together (4)
pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
    • 10 ug

USD 750.00


Mouse monoclonal turboGFP antibody, clone OTI2H8
    • 100 ul

USD 412.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Other products for "Atg12"

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag TurboGFP
Symbol Atg12
Synonyms 4931423H11Rik; A330058M13Rik; Apg12l; Atg12l
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MG200886 representing NM_026217
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCGGAAGATTCAGAGGTTGTGCTGCAGCTCCCCTCGGCTCCTGTAGGAGCCGGCGGCGAGAGCCTTC
CAGAGCTCTCCCCGGAAACAGCCACCCCAGAGCCCCCGTCCTCGGCTGCAGTTTCGCCCGGAACGGAGGA
ACCTCCCGGAGACACCAAGAAAAAAATTGACATCCTGCTGAAGGCTGTAGGAGACACTCCTATAATGAAA
ACAAAGAAATGGGCTGTGGAGCGAACCCGGACCATCCAAGGACTCATTGACTTCATCAAAAAGTTCCTTA
AACTGGTGGCCTCGGAACAGTTGTTTATTTATGTGAATCAGTCCTTTGCCCCTTCCCCAGACCAAGAAGT
TGGAACTCTATATGAGTGTTTTGGCAGTGATGGTAAACTGGTCCTGCATTACTGCAAATCCCAGGCATGG
GGA


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>MG200886 representing NM_026217
Red=Cloning site Green=Tags(s)

MSEDSEVVLQLPSAPVGAGGESLPELSPETATPEPPSSAAVSPGTEEPPGDTKKKIDILLKAVGDTPIMK
TKKWAVERTRTIQGLIDFIKKFLKLVASEQLFIYVNQSFAPSPDQEVGTLYECFGSDGKLVLHYCKSQAW
G

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_026217
ORF Size 420 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_026217.3
RefSeq Size 2459 bp
RefSeq ORF 426 bp
Locus ID 67526
UniProt ID Q9CQY1
Cytogenetics 18 C
Gene Summary Ubiquitin-like protein involved in autophagy vesicles formation. Conjugation with ATG5 through a ubiquitin-like conjugating system involving also ATG7 as an E1-like activating enzyme and ATG10 as an E2-like conjugating enzyme, is essential for its function. The ATG12-ATG5 conjugate acts as an E3-like enzyme which is required for lipidation of ATG8 family proteins and their association to the vesicle membranes.[UniProtKB/Swiss-Prot Function]

Other Versions

{0} Product Review(s)

0 Product Review(s)

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.