Atg12 (NM_026217) Mouse Tagged ORF Clone

CAT#: MG200886

Atg12 (GFP-tagged) - Mouse autophagy-related 12 (yeast) (Atg12)

  • TrueORF®

Need custom modification / cloning service?
Get a free quote

Mouse Protein / Lysate Request

USD 443.00


Availability*
3 Weeks

Size
    • 10 ug

Cited in 1 publication.

Product images

Specifications

Product Data
Product Name Atg12 (NM_026217) Mouse Tagged ORF Clone
Symbol Atg12
Synonyms 4931423H11Rik; A330058M13Rik; Apg12l; Atg12l
Vector pCMV6-AC-GFP
Sequence Data
>MG200886 representing NM_026217
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCGGAAGATTCAGAGGTTGTGCTGCAGCTCCCCTCGGCTCCTGTAGGAGCCGGCGGCGAGAGCCTTC
CAGAGCTCTCCCCGGAAACAGCCACCCCAGAGCCCCCGTCCTCGGCTGCAGTTTCGCCCGGAACGGAGGA
ACCTCCCGGAGACACCAAGAAAAAAATTGACATCCTGCTGAAGGCTGTAGGAGACACTCCTATAATGAAA
ACAAAGAAATGGGCTGTGGAGCGAACCCGGACCATCCAAGGACTCATTGACTTCATCAAAAAGTTCCTTA
AACTGGTGGCCTCGGAACAGTTGTTTATTTATGTGAATCAGTCCTTTGCCCCTTCCCCAGACCAAGAAGT
TGGAACTCTATATGAGTGTTTTGGCAGTGATGGTAAACTGGTCCTGCATTACTGCAAATCCCAGGCATGG
GGA


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>MG200886 representing NM_026217
Red=Cloning site Green=Tags(s)

MSEDSEVVLQLPSAPVGAGGESLPELSPETATPEPPSSAAVSPGTEEPPGDTKKKIDILLKAVGDTPIMK
TKKWAVERTRTIQGLIDFIKKFLKLVASEQLFIYVNQSFAPSPDQEVGTLYECFGSDGKLVLHYCKSQAW
G

TRTRRLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_026217
ORF Size 420 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_026217.1, NP_080493
RefSeq Size 2459
RefSeq ORF 426
Locus ID 67526
Cytogenetics 18|18 C
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)