OriGene Logo

Calca (NM_007587) Mouse Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
MG200827
Calca (tGFP-tagged) - Mouse calcitonin/calcitonin-related polypeptide, alpha (Calca), transcript variant 1
Interest in protein/lysate? Submit request here!
ORF Plasmid:
tGFP DDK
AAV Particle:
DDK
  $350.00
3 Weeks*
Bulk Requests & Clone Modifications

Frequently Bought Together (5)

TA364397 Calcitonin gene-related peptide 1 (alpha-CGRP), guinea pig anti canine/mouse/rat, polyclonal.
50 ul
$855.00
TA150041 Mouse monoclonal turboGFP antibody, clone OTI2H8
100 ul
$447.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100010 pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
10 ug
$780.00

Other products for "Calca or NM_007587"

Specifications
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Calca
Synonyms C; CA; Calc; Calc1; Cg; Cgrp; CGRP-1; CGRP1; Ct; Ctn
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MG200827 representing NM_007587
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGCTTCCTGAAGTTCTCCCCTTTCCTGGTTGTCAGCATCTTGCTCCTGTACCAGGCATGCAGCCTCC
AGGCAGTGCCTTTGAGGTCAATCTTGGAAAGCAGCCCAGGCATGGCCACTCTCAGTGAAGAAGAAGTTCG
CCTGCTGGCTGCACTGGTGCAGGACTATATGCAGATGAAAGCCAGGGAGCTGGAGCAGGAGGAAGAGCAG
GAGGCTGAGGGCTCTAGCTTGGACAGCCCCAGATCTAAGCGGTGTGGGAATCTGAGTACCTGCATGCTGG
GCACGTACACACAAGACCTCAACAAGTTTCACACCTTCCCCAAAACTTCAATTGGGGTTGAAGCACCTGG
CAAGAAAAGGGATGTGGCCAAGGACTTGGAGACAAACCACCAATCCCATTTTGGCAAC

ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>MG200827 representing NM_007587
Red=Cloning site Green=Tags(s)

MGFLKFSPFLVVSILLLYQACSLQAVPLRSILESSPGMATLSEEEVRLLAALVQDYMQMKARELEQEEEQ
EAEGSSLDSPRSKRCGNLSTCMLGTYTQDLNKFHTFPKTSIGVEAPGKKRDVAKDLETNHQSHFGN

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_007587
ORF Size 408 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_007587.1, NP_031613.1
RefSeq Size 857 bp
RefSeq ORF 411 bp
Locus ID 12310
UniProt ID P70160
Cytogenetics 7 59.99 cM
Summary This gene encodes the peptide hormones calcitonin, calcitonin gene-related peptide (CGRP) and katacalcin. Alternative splicing of the mRNA results in multiple variants that encode either calcitonin or CGRP preproproteins. Post-translational processing of the calcitonin and CGRP propeptides results in either calcitonin and katacalcin, or CGRP, respectively. Calcitonin and katacalcin modulate calcium levels in the blood stream. CGRP can function as a vasodilator and play a role in the transmission of pain. The human homolog of CGRP was found to have antimicrobial activity. provided by RefSeq, Mar 2015
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources
"NM_007587" in other vectors (4)
SKU Description Size Price
MC201376 Calca (untagged) - Mouse calcitonin/calcitonin-related polypeptide, alpha (Calca), transcript variant 1, (10ug) 10 ug
$150.00
MR200827 Calca (Myc-DDK-tagged) - Mouse calcitonin/calcitonin-related polypeptide, alpha (Calca), transcript variant 1 10 ug
$289.00
MR200827L3 Lenti ORF clone of Calca (Myc-DDK-tagged) - Mouse calcitonin/calcitonin-related polypeptide, alpha (Calca), transcript variant 1 10 ug
$450.00
MR200827L4 Lenti ORF clone of Calca (mGFP-tagged) - Mouse calcitonin/calcitonin-related polypeptide, alpha (Calca), transcript variant 1 10 ug
$450.00

Welcome to OriGene AI!

I'm your AI-powered guide to everything OriGene.
Ask me anything:

  • Product specs
  • Ordering help
  • Technical questions
  • How to find exactly what your experiment needs

Prefer a live agent? Connect with us by clicking the green chat icon, as seen in the image below or email our team at custsupport@origene.com.

Velaro Chat Img

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.