MGC73635 (BC062251) Mouse Tagged ORF Clone

  • TrueORF®
SKU
MG200736
MGC73635 (tGFP-tagged) - Mouse similar to histone 2a (cDNA clone MGC:73635 IMAGE:1224905)
  $350.00
3 Weeks*
Specifications
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol MGC73635
Synonyms ENSMUSG00000060262; Gm11276; OTTMUSG00000000448
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MG200736 representing BC062251
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCTGGACGCGGCAAGCAGGGTGGCAAGGCTCGCGCCAAGGCCAAGACCCGCTCCTCCCGGGCCGGCC
TGCAGTTCCCCGTGGGCCGCGTGCACCGGCTGCTCCGCAAGGGCAACTACTCGGAGCGCGTGGGCGCCGG
CGCCCCGGTCTACCTGGCGGCCGTGCTGGAGTACCTGACGGCCGAGATCCTGGAGCTGGCGGGCAACGCG
GCCCGCGACAACAAGAAGACGCGCATCATCCCGCGCCACCTGCAGCTGGCCATCCGCAACGACGAGGAGC
TCAACAAGCTGCTGGGCCGCGTGACCATCGCGCAGGGCGGCGTCCTGCCCAACATCCAGGCCGTGCTGCT
GCCCAAGAAGACCGAGAGCCACCACAAGGCCAAGGGAAAA


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>MG200736 representing BC062251
Red=Cloning site Green=Tags(s)

MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNA
ARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKKTESHHKAKGK

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN BC062251
ORF Size 390 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq BC062251, AAH62251
RefSeq Size 444 bp
RefSeq ORF 392 bp
Locus ID 665433
Cytogenetics 13 A3.1
Summary Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. This structure consists of approximately 146 bp of DNA wrapped around a nucleosome, an octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene is intronless and encodes a replication-dependent histone that is a member of the histone H2A family. Transcripts from this gene lack polyA tails; instead, they contain a palindromic termination element. provided by RefSeq, Aug 2015
Reviews
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources
"BC062251" in other vectors (4)
SKU Description Size Price
MC207006 MGC73635 (untagged) - Mouse similar to histone 2a (cDNA clone MGC:73635 IMAGE:1224905), (10ug) 10 ug
$165.00
MR200736 MGC73635 (Myc-DDK-tagged) - Mouse similar to histone 2a (cDNA clone MGC:73635 IMAGE:1224905) 10 ug
$289.00
MR200736L3 Lenti ORF clone of MGC73635 (Myc-DDK-tagged) - Mouse similar to histone 2a (cDNA clone MGC:73635 IMAGE:1224905) 10 ug
$450.00
MR200736L4 Lenti ORF clone of MGC73635 (mGFP-tagged) - Mouse similar to histone 2a (cDNA clone MGC:73635 IMAGE:1224905) 10 ug
$450.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.