Cox5b (NM_009942) Mouse Tagged ORF Clone

CAT#: MG200704

  • TrueORF®

Cox5b (GFP-tagged) - Mouse cytochrome c oxidase, subunit Vb (Cox5b)

  View "NM_009942" in other vectors (6)

USD 460.00


Availability*
3 Weeks

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name Cox5b (NM_009942) Mouse Tagged ORF Clone
Symbol Cox5b
Synonyms MGC117683
Vector pCMV6-AC-GFP
Sequence Data
>MG200704 representing NM_009942
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTTCAAGGTTACTTCGCGGAGTGGGCGCTTTGGCGGCGCAGGCCCTGAGGGCCCACGGCCCCCGTG
GCGCGGCCGTGACCCGCTCCATGGCTTCTGGAGGTGGTGTCCCCACTGATGAGGAGCAGGCTACTGGGCT
GGAGAGGGAGATCATGATAGCAGCACAGAAGGGACTGGACCCATACAATATGCTACCTCCAAAGGCAGCT
TCAGGCACCAAGGAAGACCCTAATCTAGTCCCGTCCATCAGCAACAAGAGAATAGTGGGCTGCATCTGTG
AAGAGGACAACTGTACTGTCATCTGGTTTTGGCTGCACAAAGGCGAGAGTCAGCGATGCCCCAACTGTGG
AACCCATTACAAGCTGGTGCCCCACCAAATGGCCCAC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>MG200704 representing NM_009942
Red=Cloning site Green=Tags(s)

MASRLLRGVGALAAQALRAHGPRGAAVTRSMASGGGVPTDEEQATGLEREIMIAAQKGLDPYNMLPPKAA
SGTKEDPNLVPSISNKRIVGCICEEDNCTVIWFWLHKGESQRCPNCGTHYKLVPHQMAH

TRTRRLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_009942
ORF Size 387 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_009942.2, NP_034072
RefSeq Size 584
RefSeq ORF 390
Locus ID 12859
Cytogenetics 1|1 B

Other Versions

Other products for "Cox5b"
Frequently bought together (2)
pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
    • 10 ug

USD 618.00


Mouse monoclonal turboGFP antibody, clone OTI2H8
    • 100 ul

USD 299.00

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
10 percent off protein banner ad
68 Mouse Clones
20%off selected tag antibodies