Polr2i (NM_027259) Mouse Tagged ORF Clone

CAT#: MG200650

Polr2i (tGFP-tagged) - Mouse polymerase (RNA) II (DNA directed) polypeptide I (Polr2i)

Product Images

Circular map for MG200650

Specifications

Product Data

• Type: Mouse Tagged ORF Clone
• Tag: TurboGFP
• Symbol: Polr2i
• Synonyms: 2810002B19Rik
• Vector: pCMV6-AC-GFP
• E. coli Selection: Ampicillin (100 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >MG200650 representing NM_027259
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGGAACCCGACGGGACGTACGAGCCTGGCTTCGTGGGTATTCGGTTCTGCCAGGAATGTAATAACATGC
  TGTACCCCAAGGAGGACAAGGAAAATCGCATTCTGCTGTACGCGTGCCGGAATTGCGATTACCAGCAGGA
  AGCCGACAACAGCTGCATCTACGTCAACAAAATCACGCACGAAGTGGACGAGCTGACCCAGATCATCGCA
  GACGTGTCCCAGGACCCCACGTTGCCCCGGACGGAGGACCACCCGTGCCAGAAGTGTGGCCACAAGGAGG
  CAGTGTTCTTTCAGTCACACAGTGCCCGAGCTGAGGACGCCATGCGCCTGTACTATGTTTGCACTGCCCC
  ACACTGCGGCCACCGCTGGACTGAG
  
  AGCGGACCGACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
  Protein Sequence

  >MG200650 representing NM_027259
  Red=Cloning site Green=Tags(s)
  
  MEPDGTYEPGFVGIRFCQECNNMLYPKEDKENRILLYACRNCDYQQEADNSCIYVNKITHEVDELTQIIA
  DVSQDPTLPRTEDHPCQKCGHKEAVFFQSHSARAEDAMRLYYVCTAPHCGHRWTE
  
  SGPTRTRRLE - GFP Tag - V
• Restriction Sites: SgfI-RsrII Cloning Scheme for this gene Plasmid Map
• ACCN: NM_027259
• ORF Size: 375 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_027259.1, NP_081535.1
• RefSeq Size: 707 bp
• RefSeq ORF: 378 bp
• Locus ID: 69920
• UniProt ID: P60898
• Cytogenetics: 7 B1
• Gene Summary: DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Component of RNA polymerase II which synthesizes mRNA precursors and many functional non-coding RNAs. Pol II is the central component of the basal RNA polymerase II transcription machinery. It is composed of mobile elements that move relative to each other. RPB9 is part of the upper jaw surrounding the central large cleft and thought to grab the incoming DNA template (By similarity).[UniProtKB/Swiss-Prot Function]