Bloc1s1 (NM_015740) Mouse Tagged ORF Clone

CAT#: MG200647

Bloc1s1 (tGFP-tagged) - Mouse biogenesis of lysosome-related organelles complex-1, subunit 1 (Bloc1s1)

Product Images

Circular map for MG200647

Specifications

Product Data

• Type: Mouse Tagged ORF Clone
• Tag: TurboGFP
• Symbol: Bloc1s1
• Synonyms: AI839753; BLOS1; Gcn5l1
• Vector: pCMV6-AC-GFP
• E. coli Selection: Ampicillin (100 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >MG200647 representing NM_015740
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGCTGTCCCGCCTGCTCAAAGAACACCAAGCCAAGCAGAACGAACGCAAGGAGCTGCAGGAGAAGAGGA
  GGAGAGAAGCTATCGCTGCAGCGACCTGCCTGACCGAAGCGTTGGTGGATCACCTCAACGTGGGTGTGGC
  CCAGGCCTACATGAACCAGAGAAAGCTGGACCATGAGGTGAAGACTCTACAGGTCCAGGCTGCCCAGTTT
  GCCAAGCAGACAGGCCAGTGGATTGGAATGGTGGAGAACTTCAACCAGGCACTTAAGGAAATTGGGGATG
  TGGAGAACTGGGCTAGGAGCATCGAGCTGGACATGCGCACCATTGCCACTGCGCTGGAATACGTCTACAA
  AGGGCAGCTGCAGTCTGCACCATCC
  
  ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
  Protein Sequence

  >MG200647 representing NM_015740
  Red=Cloning site Green=Tags(s)
  
  MLSRLLKEHQAKQNERKELQEKRRREAIAAATCLTEALVDHLNVGVAQAYMNQRKLDHEVKTLQVQAAQF
  AKQTGQWIGMVENFNQALKEIGDVENWARSIELDMRTIATALEYVYKGQLQSAPS
  
  TRTRPLE - GFP Tag - V
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_015740
• ORF Size: 375 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_015740.3
• RefSeq Size: 551 bp
• RefSeq ORF: 378 bp
• Locus ID: 14533
• UniProt ID: O55102
• Cytogenetics: 10 77.19 cM
• Gene Summary: Component of the BLOC-1 complex, a complex that is required for normal biogenesis of lysosome-related organelles (LRO), such as platelet dense granules and melanosomes. In concert with the AP-3 complex, the BLOC-1 complex is required to target membrane protein cargos into vesicles assembled at cell bodies for delivery into neurites and nerve terminals. The BLOC-1 complex, in association with SNARE proteins, is also proposed to be involved in neurite extension (PubMed:16760431, PubMed:19546860, PubMed:21998198). As part of the BORC complex may play a role in lysosomes movement and localization at the cell periphery. The BORC complex is most probably associated with the cytosolic face of lysosomes, may recruit ARL8B and couple lysosomes to microtubule plus-end-directed kinesin motor (By similarity).[UniProtKB/Swiss-Prot Function]