Qrfp (NM_183424) Mouse Tagged ORF Clone

CAT#: MG200640

Qrfp (tGFP-tagged) - Mouse cDNA sequence BC094274 (BC094274)

Product Images

Circular map for MG200640

Specifications

Product Data

• Type: Mouse Tagged ORF Clone
• Tag: TurboGFP
• Symbol: Qrfp
• Synonyms: P51; P518; QR
• Vector: pCMV6-AC-GFP
• E. coli Selection: Ampicillin (100 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >MG200640 representing NM_183424
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGAGGGGCTTCCGGCCTTTGCTTTCCCTACTTCTCCCTCTGAGTGCCTGCTTTCCCCTGCTGGACAGAA
  GGGGACCCACAGACATCGGTGACATCGGAGCCAGGATGAGCTGGGCCCAGCTGGCTGAGGGACACCCCCC
  CAACTCGGTTCAAAATCCACAGCCACAGGCCCTGCTTGTGGTGGCCAAGGAGCAGCAGGCCTCCCACAGG
  GAGCACACCGGCTTCCGTCTAGGGAGGCAAGACGGTAGCAGTGAGGCCGCAGGGTTCCTGCCCGCCGACT
  CGGAGAAGGCCAGCGGCCCTCTGGGGACTCTGGCAGAGGAGCTGAGCAGCTACAGCCGGAGGAAGGGAGG
  CTTCAGCTTCCGCTTTGGACGG
  
  ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
  Protein Sequence

  >MG200640 representing NM_183424
  Red=Cloning site Green=Tags(s)
  
  MRGFRPLLSLLLPLSACFPLLDRRGPTDIGDIGARMSWAQLAEGHPPNSVQNPQPQALLVVAKEQQASHR
  EHTGFRLGRQDGSSEAAGFLPADSEKASGPLGTLAEELSSYSRRKGGFSFRFGR
  
  TRTRPLE - GFP Tag - V
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_183424
• ORF Size: 372 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_183424.1, NP_906269.1
• RefSeq Size: 2866 bp
• RefSeq ORF: 375 bp
• Locus ID: 227717
• UniProt ID: Q8CE23
• Cytogenetics: 2 B
• Gene Summary: This gene encodes a preproprotein that is proteolytically processed to generate multiple protein products. The encoded products are members of the RFamide family of neuropeptides, characterized by their common protein C-terminus consisting of an arginine (R) and an amidated phenylalanine (F). These products include the neuropeptides QRFP-26 (26RFa) and the N-terminally extended form, QRFP-43 (43RFa). Both of these neuropeptides bind to the pyroglutamylated RFamide peptide receptor (QRFPR) and may regulate blood pressure, reproduction and food intake. [provided by RefSeq, Sep 2015]