Atp6v1g1 (NM_024173) Mouse Tagged ORF Clone

  • TrueORF®
SKU
MG200546
Atp6v1g1 (tGFP-tagged) - Mouse ATPase, H+ transporting, lysosomal V1 subunit G1 (Atp6v1g1)
  $350.00
3 Weeks*
Specifications
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Atp6v1g1
Synonyms 1810024D14Rik; AA960677; Atp6g1; ATP6J; VAG1; Vma10
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MG200546 representing NM_024173
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGAGTCAGTCGCAGGGCATCCAGCAGCTACTGCAGGCCGAGAAGCGGGCCGCCGAGAAGGTGTCCG
AGGCCCGCAAGCGAAAGAACCGGAGGCTGAAGCAGGCCAAAGAAGAAGCCCAGGCTGAAATTGAACAGTA
CCGCCTGCAGAGGGAGAAGGAGTTCAAGGCCAAGGAAGCTGCGGCATTGGGCTCCCATGGCAGCTGCAGC
AGTGAGGTGGAAAAGGAGACCCGGGAGAAGATGACCGTCCTCCAGAACTACTTCGAGCAGAACAGGGATG
AAGTCCTGGATAACCTCTTGGCCTTTGTGTGTGACATCCGGCCGGAAATCCATGAAAACTACCGCATAAA
CGGA


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>MG200546 representing NM_024173
Red=Cloning site Green=Tags(s)

MASQSQGIQQLLQAEKRAAEKVSEARKRKNRRLKQAKEEAQAEIEQYRLQREKEFKAKEAAALGSHGSCS
SEVEKETREKMTVLQNYFEQNRDEVLDNLLAFVCDIRPEIHENYRING

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_024173
ORF Size 354 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_024173.2, NP_077135.1
RefSeq Size 1104 bp
RefSeq ORF 357 bp
Locus ID 66290
UniProt ID Q9CR51
Cytogenetics 4 B3
Summary Catalytic subunit of the peripheral V1 complex of vacuolar ATPase (V-ATPase). V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells. In aerobic conditions, involved in intracellular iron homeostasis, thus triggering the activity of Fe(2+) prolyl hydroxylase (PHD) enzymes, and leading to HIF1A hydroxylation and subsequent proteasomal degradation (By similarity).UniProtKB/Swiss-Prot Function
Reviews
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources
"NM_024173" in other vectors (4)
SKU Description Size Price
MC210320 Atp6v1g1 (untagged) - Mouse ATPase, H+ transporting, lysosomal V1 subunit G1 (Atp6v1g1), (10ug) 10 ug
$165.00
MR200546 Atp6v1g1 (Myc-DDK-tagged) - Mouse ATPase, H+ transporting, lysosomal V1 subunit G1 (Atp6v1g1) 10 ug
$289.00
MR200546L3 Lenti ORF clone of Atp6v1g1 (Myc-DDK-tagged) - Mouse ATPase, H+ transporting, lysosomal V1 subunit G1 (Atp6v1g1) 10 ug
$450.00
MR200546L4 Lenti ORF clone of Atp6v1g1 (mGFP-tagged) - Mouse ATPase, H+ transporting, lysosomal V1 subunit G1 (Atp6v1g1) 10 ug
$450.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.