Dynlt3 (NM_025975) Mouse Tagged ORF Clone

CAT#: MG200504

Dynlt3 (tGFP-tagged) - Mouse dynein light chain Tctex-type 3 (Dynlt3)

Product Images

Circular map for MG200504

Specifications

Product Data

• Type: Mouse Tagged ORF Clone
• Tag: TurboGFP
• Symbol: Dynlt3
• Synonyms: 2310075M16Rik; AU042796; Tcte1l
• Vector: pCMV6-AC-GFP
• E. coli Selection: Ampicillin (100 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >MG200504 representing NM_025975
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGGAGGGGTACCAACGGCCCTGCGATGAGGTTGGCTTCAATGCTGATGAAGCCCATAATATAGTCAAAG
  AGTGTGTTGATGGAGTTTTGGGTGGTAACGATTATAATGAGAATAACATCAACCAATGGACTGCAAGCAT
  AGTGGAACAGTCTATAACACATTTGGTCAAACTGGGGAAAGCTTACAAGTACATTGTGACCTGTGCAGTG
  GTCCAGAGGAGCCCGTATGGATTTCACACAGCCAGCTCCTGTTTTTGGGATACAACATCTGATGGAACCT
  GTACCATCAGATGGGAGAACCGTACCATGAACTGCATCGTGAATGTTTTTGCAGTTGCGATTGTCCTG
  
  ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
  Protein Sequence

  >MG200504 representing NM_025975
  Red=Cloning site Green=Tags(s)
  
  MEGYQRPCDEVGFNADEAHNIVKECVDGVLGGNDYNENNINQWTASIVEQSITHLVKLGKAYKYIVTCAV
  VQRSPYGFHTASSCFWDTTSDGTCTIRWENRTMNCIVNVFAVAIVL
  
  TRTRPLE - GFP Tag - V
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_025975
• ORF Size: 348 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_025975.5
• RefSeq Size: 2155 bp
• RefSeq ORF: 351 bp
• Locus ID: 67117
• UniProt ID: P56387
• Cytogenetics: X A1.1
• Gene Summary: Acts as one of several non-catalytic accessory components of the cytoplasmic dynein 1 complex that are thought to be involved in linking dynein to cargos and to adapter proteins that regulate dynein function. Cytoplasmic dynein 1 acts as a motor for the intracellular retrograde motility of vesicles and organelles along microtubules. Probably binds BUB3 as part of transport cargo. Required for the efficient progression through mitosis.[UniProtKB/Swiss-Prot Function]