OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Sh3bgrl2 (NM_172507) Mouse Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
MG200387
Sh3bgrl2 (tGFP-tagged) - Mouse SH3 domain binding glutamic acid-rich protein like 2 (Sh3bgrl2)
Interest in protein/lysate? Submit request here!
ORF Plasmid:
tGFP DDK
AAV Particle:
DDK
  $350.00
3 Weeks*
Bulk Requests & Clone Modifications

Frequently Bought Together (4)

TA150041 Mouse monoclonal turboGFP antibody, clone OTI2H8 100 ul
$447.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100010 pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
10 ug
$780.00

Other products for "Sh3bgrl2 or NM_172507"

Specifications
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Sh3bgrl2
Synonyms A930014C21Rik; AA408038; B930089I21
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MG200387 representing NM_172507
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGTGGTCCGCGTCTTCGTCGCCTCATGCTCAGGCTTCGTGGCGATCAAGAAGAAGCAGCAGGATGTGG
TTCGGTTTCTGGAAGCCAACAAGATAGAGTTCGAGGAAGTGGACATCACCATGTCGGAAGAACAGAGGCA
GTGGATGTACAAAAACATTCCCCCTGAGAAGAAGCCTGCGCAGGGCAACCCTCTGCCACCTCAGATATTT
AATGGGGATCGATACTGTGGAGACTATGACAGTTTTTTTGAATCGAAGGAAAGCAACACAGTCTTTTCAT
TCTTAGGCCTGAAGCCACGGCCGGCATCCACGGCGGAACCT

ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>MG200387 representing NM_172507
Red=Cloning site Green=Tags(s)

MVVRVFVASCSGFVAIKKKQQDVVRFLEANKIEFEEVDITMSEEQRQWMYKNIPPEKKPAQGNPLPPQIF
NGDRYCGDYDSFFESKESNTVFSFLGLKPRPASTAEP

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_172507
ORF Size 321 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_172507.5
RefSeq Size 3553 bp
RefSeq ORF 324 bp
Locus ID 212531
UniProt ID Q8BG73
Cytogenetics 9 E2
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_172507" in other vectors (4)
SKU Description Size Price
MC204432 Sh3bgrl2 (untagged) - Mouse SH3 domain binding glutamic acid-rich protein like 2 (Sh3bgrl2), (10ug) 10 ug
$150.00
MR200387 Sh3bgrl2 (Myc-DDK-tagged) - Mouse SH3 domain binding glutamic acid-rich protein like 2 (Sh3bgrl2) 10 ug
$289.00
MR200387L3 Lenti ORF clone of Sh3bgrl2 (Myc-DDK-tagged) - Mouse SH3 domain binding glutamic acid-rich protein like 2 (Sh3bgrl2) 10 ug
$450.00
MR200387L4 Lenti ORF clone of Sh3bgrl2 (mGFP-tagged) - Mouse SH3 domain binding glutamic acid-rich protein like 2 (Sh3bgrl2) 10 ug
$450.00

Plasmid Map for MG200387

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for MG200387
Circular map for MG200387

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products