OriGene Logo

Wdr83os (NM_001001493) Mouse Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
MG200372
BC056474 (tGFP-tagged) - Mouse cDNA sequence BC056474 (BC056474)
Interest in protein/lysate? Submit request here!
ORF Plasmid:
tGFP DDK
AAV Particle:
DDK
  $350.00
3 Weeks*
Bulk Requests & Clone Modifications

Frequently Bought Together (4)

TA150041 Mouse monoclonal turboGFP antibody, clone OTI2H8
100 ul
$447.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100010 pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
10 ug
$780.00

Other products for "Wdr83os or NM_001001493"

Specifications
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Wdr83os
Synonyms Wdr83os
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MG200372 representing NM_001001493
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCCACTAACAATATGTCCGACCCACGAAGGCCCAACAAAGTGCTGAGGTATAAGCCTCCCCCGAGTG
AGTGCAACCCGGCTTTAGACGACCCGACTCCGGACTACATGAATCTTCTTGGCATGATCTTCAGCATGTG
TGGCCTCATGCTTAAGCTGAAGTGGTGTGCTTGGGTTGCTGTCTACTGCTCCTTTATCAGCTTTGCCAAC
TCGCGGAGCTCGGAGGACACTAAGCAGATGATGAGTAGCTTCATGCTCTCTATCTCCGCCGTGGTGATGT
CCTATCTGCAGAATCCTCAGCCCATGACGCCTCCCTGG

ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>MG200372 representing NM_001001493
Red=Cloning site Green=Tags(s)

MSTNNMSDPRRPNKVLRYKPPPSECNPALDDPTPDYMNLLGMIFSMCGLMLKLKWCAWVAVYCSFISFAN
SRSSEDTKQMMSSFMLSISAVVMSYLQNPQPMTPPW

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_001001493
ORF Size 318 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001001493.2, NP_001001493.1
RefSeq Size 815 bp
RefSeq ORF 321 bp
Locus ID 414077
UniProt ID Q6ZWX0
Cytogenetics 8 C3
Summary Component of the PAT complex, an endoplasmic reticulum (ER)-resident membrane multiprotein complex that facilitates multi-pass membrane proteins insertion into membranes. The PAT complex acts as an intramembrane chaperone by directly interacting with nascent transmembrane domains (TMDs), releasing its substrates upon correct folding, and is needed for optimal biogenesis of multi-pass membrane proteins. WDR83OS/Asterix is the substrate-interacting subunit of the PAT complex, whereas CCDC47 is required to maintain the stability of WDR83OS/Asterix. WDR83OS/Asterix associates with the first transmembrane domain (TMD1) of the nascent chain, independently of the N-glycosylation of the chain and irrespective of the amino acid sequence and transmembrane topology of TMD1. The PAT complex favors the binding to TMDs with exposed hydrophilic amino acids within the lipid bilayer and provides a membrane-embedded partially hydrophilic environment in which TMD1 binds.UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources
"NM_001001493" in other vectors (4)
SKU Description Size Price
MC207977 BC056474 (untagged) - Mouse cDNA sequence BC056474 (BC056474), (10ug) 10 ug
$165.00
MR200372 BC056474 (Myc-DDK-tagged) - Mouse cDNA sequence BC056474 (BC056474) 10 ug
$289.00
MR200372L3 Lenti ORF clone of BC056474 (Myc-DDK-tagged) - Mouse cDNA sequence BC056474 (BC056474) 10 ug
$450.00
MR200372L4 Lenti ORF clone of BC056474 (mGFP-tagged) - Mouse cDNA sequence BC056474 (BC056474) 10 ug
$450.00

Welcome to OriGene AI!

I'm your AI-powered guide to everything OriGene.
Ask me anything:

  • Product specs
  • Ordering help
  • Technical questions
  • How to find exactly what your experiment needs

Prefer a live agent? Connect with us by clicking the green chat icon, as seen in the image below or email our team at custsupport@origene.com.

Velaro Chat Img

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.