Kcne3 (NM_020574) Mouse Tagged ORF Clone

CAT#: MG200339

Kcne3 (tGFP-tagged) - Mouse potassium voltage-gated channel, Isk-related subfamily, gene 3 (Kcne3)

Product Images

Circular map for MG200339

Specifications

Product Data

• Type: Mouse Tagged ORF Clone
• Tag: TurboGFP
• Symbol: Kcne3
• Synonyms: 2210017H05Rik; MiRP2
• Vector: pCMV6-AC-GFP
• E. coli Selection: Ampicillin (100 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >MG200339 representing NM_020574
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGGAGACTTCCAACGGGACTGAGACCTGGTACATGAGCCTCCATGCTGTGCTGAAGGCTCTGAACACAA
  CCCTTCACAGTCACTTGCTCTGCCGGCCTGGGCCAGGACCAGGGCCAGACAATCAAACTGAGGATCGTCG
  GGCTAGCCTTCCTGGTCGTAATGACAACTCCTACATGTATATTCTCTTTGTCATGTTCCTATTTGCCGTC
  ACTGTGGGCAGTCTCATCCTGGGATATACCCGTTCACGCAAAGTGGACAAACGTAGTGACCCCTATCATG
  TGTACATCAAGAACCGTGTGTCTATGATC
  
  ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
  Protein Sequence

  >MG200339 representing NM_020574
  Red=Cloning site Green=Tags(s)
  
  METSNGTETWYMSLHAVLKALNTTLHSHLLCRPGPGPGPDNQTEDRRASLPGRNDNSYMYILFVMFLFAV
  TVGSLILGYTRSRKVDKRSDPYHVYIKNRVSMI
  
  TRTRPLE - GFP Tag - V
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_020574
• ORF Size: 1028 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_020574.5, NP_065599.1
• RefSeq Size: 1016 bp
• RefSeq ORF: 312 bp
• Locus ID: 57442
• UniProt ID: Q9WTW2
• Cytogenetics: 7 E2
• Gene Summary: Ancillary protein that assembles as a beta subunit with a voltage-gated potassium channel complex of pore-forming alpha subunits. Modulates the gating kinetics and enhances stability of the channel complex. Assembled with KCNB1 modulates the gating characteristics of the delayed rectifier voltage-dependent potassium channel KCNB1. Associated with KCNC4/Kv3.4 is proposed to form the subthreshold voltage-gated potassium channel in skeletal muscle and to establish the resting membrane potential (RMP) in muscle cells. Associated with KCNQ1/KCLQT1 may form the intestinal cAMP-stimulated potassium channel involved in chloride secretion that produces a current with nearly instantaneous activation with a linear current-voltage relationship.[UniProtKB/Swiss-Prot Function]