OriGene Logo

Kcne3 (NM_020574) Mouse Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
MG200339
Kcne3 (tGFP-tagged) - Mouse potassium voltage-gated channel, Isk-related subfamily, gene 3 (Kcne3)
Interest in protein/lysate? Submit request here!
ORF Plasmid:
tGFP tGFP DDK
AAV Particle:
DDK
  $350.00
3 Weeks*
Bulk Requests & Clone Modifications

Frequently Bought Together (4)

TA150041 Mouse monoclonal turboGFP antibody, clone OTI2H8
100 ul
$447.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100010 pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
10 ug
$780.00

Other products for "Kcne3 or NM_020574"

Specifications
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Kcne3
Synonyms 2210017H05Rik; MiRP2
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MG200339 representing NM_020574
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGACTTCCAACGGGACTGAGACCTGGTACATGAGCCTCCATGCTGTGCTGAAGGCTCTGAACACAA
CCCTTCACAGTCACTTGCTCTGCCGGCCTGGGCCAGGACCAGGGCCAGACAATCAAACTGAGGATCGTCG
GGCTAGCCTTCCTGGTCGTAATGACAACTCCTACATGTATATTCTCTTTGTCATGTTCCTATTTGCCGTC
ACTGTGGGCAGTCTCATCCTGGGATATACCCGTTCACGCAAAGTGGACAAACGTAGTGACCCCTATCATG
TGTACATCAAGAACCGTGTGTCTATGATC

ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>MG200339 representing NM_020574
Red=Cloning site Green=Tags(s)

METSNGTETWYMSLHAVLKALNTTLHSHLLCRPGPGPGPDNQTEDRRASLPGRNDNSYMYILFVMFLFAV
TVGSLILGYTRSRKVDKRSDPYHVYIKNRVSMI

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_020574
ORF Size 309 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_020574.5, NP_065599.1
RefSeq Size 1016 bp
RefSeq ORF 312 bp
Locus ID 57442
UniProt ID Q9WTW2
Cytogenetics 7 E2
Summary Ancillary protein that assembles as a beta subunit with a voltage-gated potassium channel complex of pore-forming alpha subunits. Modulates the gating kinetics and enhances stability of the channel complex. Assembled with KCNB1 modulates the gating characteristics of the delayed rectifier voltage-dependent potassium channel KCNB1. Associated with KCNC4/Kv3.4 is proposed to form the subthreshold voltage-gated potassium channel in skeletal muscle and to establish the resting membrane potential (RMP) in muscle cells. Associated with KCNQ1/KCLQT1 may form the intestinal cAMP-stimulated potassium channel involved in chloride secretion that produces a current with nearly instantaneous activation with a linear current-voltage relationship.UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources
"NM_020574" in other vectors (5)
SKU Description Size Price
MC200237 Kcne3 (untagged) - Mouse potassium voltage-gated channel, Isk-related subfamily, gene 3 (Kcne3), transcript variant 2, (10ug) 10 ug
$150.00
MG222383 Kcne3 (tGFP-tagged) - Mouse potassium voltage-gated channel Isk-related subfamily gene 3 (Kcne3) transcript variant 2, (10ug) 10 ug
$350.00
MR222383 Kcne3 (Myc-DDK-tagged) - Mouse potassium voltage-gated channel, Isk-related subfamily, gene 3 (Kcne3), transcript variant 2 10 ug
$289.00
MR222383L3 Lenti ORF clone of Kcne3 (Myc-DDK-tagged) - Mouse potassium voltage-gated channel, Isk-related subfamily, gene 3 (Kcne3), transcript variant 2 10 ug
$450.00
MR222383L4 Lenti ORF clone of Kcne3 (mGFP-tagged) - Mouse potassium voltage-gated channel, Isk-related subfamily, gene 3 (Kcne3), transcript variant 2 10 ug
$450.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.