Lsm3 (NM_026309) Mouse Tagged ORF Clone

CAT#: MG200330

Lsm3 (tGFP-tagged) - Mouse LSM3 homolog, U6 small nuclear RNA associated (S

Product Images

Circular map for MG200330

Specifications

Product Data

• Type: Mouse Tagged ORF Clone
• Tag: TurboGFP
• Symbol: Lsm3
• Synonyms: 1010001J12Rik; 2610005D18Rik; 6030401D18Rik; SMX4; USS2
• Vector: pCMV6-AC-GFP
• E. coli Selection: Ampicillin (100 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >MG200330 representing NM_026309
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGGCGGACGACGTAGATCAGCAACAGACCACCAATACCGTAGAGGAGCCCCTGGATCTGATCAGGCTCA
  GCCTGGATGAGCGAATTTATGTGAAAATGAGAAATGACCGAGAGCTTCGAGGCAGACTACACGCTTATGA
  TCAACATTTAAATATGATCCTGGGAGATGTAGAAGAAACTGTGACAACGATAGAGATTGATGAGGAGACA
  TATGAAGAGATATATAAATCCACAAAACGAAACATCCCTATGCTCTTCGTCCGGGGAGATGGCGTCGTTC
  TAGTCGCCCCTCCATTGAGAGTTGGC
  
  ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
  Protein Sequence

  >MG200330 representing NM_026309
  Red=Cloning site Green=Tags(s)
  
  MADDVDQQQTTNTVEEPLDLIRLSLDERIYVKMRNDRELRGRLHAYDQHLNMILGDVEETVTTIEIDEET
  YEEIYKSTKRNIPMLFVRGDGVVLVAPPLRVG
  
  TRTRPLE - GFP Tag - V
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_026309
• ORF Size: 306 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_026309.2
• RefSeq Size: 634 bp
• RefSeq ORF: 309 bp
• Locus ID: 67678
• UniProt ID: P62311
• Cytogenetics: 6 D1
• Gene Summary: Plays role in pre-mRNA splicing as component of the U4/U6-U5 tri-snRNP complex that is involved in spliceosome assembly, and as component of the precatalytic spliceosome (spliceosome B complex). The heptameric LSM2-8 complex binds specifically to the 3'-terminal U-tract of U6 snRNA.[UniProtKB/Swiss-Prot Function]