Psenen (NM_025498) Mouse Tagged ORF Clone

CAT#: MG200307

Psenen (tGFP-tagged) - Mouse presenilin enhancer 2 homolog (C. elegans) (Psenen)

Product Images

Circular map for MG200307

Specifications

Product Data

• Type: Mouse Tagged ORF Clone
• Tag: TurboGFP
• Symbol: Psenen
• Synonyms: 1700023M09Rik; Pen-2
• Vector: pCMV6-AC-GFP
• E. coli Selection: Ampicillin (100 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >MG200307 representing NM_025498
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGAACTTGGAGCGGGTATCCAATGAGGAGAAGTTGAACCTGTGCCGGAAGTACTATCTTGGTGGATTTG
  CGTTCCTGCCTTTTCTTTGGTTAGTCAACATTTTCTGGTTCTTCAGAGAGGCGTTCCTCGCCCCAGCCTA
  CACAGAGCAGAGCCAAATCAAAGGCTATGTTTGGCGCTCAGCTGTGGGCTTCCTCTTCTGGGTGATCATT
  CTCGCCACCTGGATCACCATCTTCCAGATCTACCGGCCCCGCTGGGGCGCTCTTGGGGACTACCTCTCCT
  TCACCATTCCCCTGGGCACTCCC
  
  ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
  Protein Sequence

  >MG200307 representing NM_025498
  Red=Cloning site Green=Tags(s)
  
  MNLERVSNEEKLNLCRKYYLGGFAFLPFLWLVNIFWFFREAFLAPAYTEQSQIKGYVWRSAVGFLFWVII
  LATWITIFQIYRPRWGALGDYLSFTIPLGTP
  
  TRTRPLE - GFP Tag - V
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_025498
• ORF Size: 303 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_025498.3
• RefSeq Size: 670 bp
• RefSeq ORF: 306 bp
• Locus ID: 66340
• UniProt ID: Q9CQR7
• Cytogenetics: 7 B1
• Gene Summary: Essential subunit of the gamma-secretase complex, an endoprotease complex that catalyzes the intramembrane cleavage of integral membrane proteins such as Notch receptors and APP (amyloid-beta precursor protein) (PubMed:12522139, PubMed:24941111). The gamma-secretase complex plays a role in Notch and Wnt signaling cascades and regulation of downstream processes via its role in processing key regulatory proteins, and by regulating cytosolic CTNNB1 levels (Probable). PSENEN modulates both endoproteolysis of presenilin and gamma-secretase activity (PubMed:12522139, PubMed:24941111).[UniProtKB/Swiss-Prot Function]