Hmga1 (BC008125) Mouse Tagged ORF Clone

CAT#: MG200266

Hmga1 (tGFP-tagged) - Mouse high mobility group AT-hook 1 (cDNA clone MGC:6198 IMAGE:3500572)

Product Images

Circular map for MG200266

Specifications

Product Data

• Type: Mouse Tagged ORF Clone
• Tag: TurboGFP
• Symbol: Hmga1
• Synonyms: HMGY, HMG-I(Y), Hmgiy, HMGI(Y)
• Vector: pCMV6-AC-GFP
• E. coli Selection: Ampicillin (100 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >MG200266 representing BC008125
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGAGCGAGTCGGGCTCAAAGTCCAGCCAGCCCCTGGCCTCCAAACAGGAAAAGGATGGGACTGAGAAGC
  GAGGCCGGGGCAGGCCACGCAAGCAGCCTCCGAAAGAGCCCAGTGAAGTGCCAACTCCGAAGAGACCTCG
  GGGCCGACCAAAGGGAAGCAAGAATAAGGGCGCCGCCAAGACCCGGAAAGTCACCACAGCTCCAGGGAGG
  AAACCAAGGGGCAGACCCAAGAAACTGGAGAAGGAGGAAGAGGAGGGCATCTCCCAGGAGTCCTCTGAGG
  AGGAGCAG
  
  ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
  Protein Sequence

  >MG200266 representing BC008125
  Red=Cloning site Green=Tags(s)
  
  MSESGSKSSQPLASKQEKDGTEKRGRGRPRKQPPKEPSEVPTPKRPRGRPKGSKNKGAAKTRKVTTAPGR
  KPRGRPKKLEKEEEEGISQESSEEEQ
  
  TRTRPLE - GFP Tag - V
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: BC008125
• ORF Size: 290 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: BC008125
• RefSeq Size: 1555 bp
• RefSeq ORF: 290 bp
• Locus ID: 15361
• Cytogenetics: 17 14.5 cM
• Gene Summary: This locus encodes a member of the nuclear, non-histone high mobility group protein family. This architectural transcription factor binds to A-T rich DNA sequences and participates in enhanceosome formation, chromatin remodeling and regulation of transcription. This protein functions in many cellular processes, including cell growth and differentiation. Alternatively spliced transcript variants have been described. [provided by RefSeq, Oct 2009]