Sf3b5 (NM_175102) Mouse Tagged ORF Clone

  • TrueORF®
SKU
MG200186
Sf3b5 (tGFP-tagged) - Mouse splicing factor 3b, subunit 5 (Sf3b5)
  $350.00
3 Weeks*
Specifications
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Sf3b5
Synonyms 10kDa; 1110005L13Rik; AU043053; Sf3b10
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MG200186 representing NM_175102
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGACGGACCGGTACACCATCCACAGCCAGCTGGAGCATCTGCAGTCCAAGTACATCGGCACGGGCCACG
CCGACACCACCAAGTGGGAATGGCTGGTGAACCAGCACCGCGACTCCTACTGCTCCTACATGGGCCACTT
CGACCTCCTCAACTACTTCGCCATTGCCGAGAACGAGAGCAAAGCCCGCGTGCGGTTCAACCTGATGGAG
AAAATGCTGCAGCCCAGCGGGCCGCCCGCGGACAAGCCCGAGGAGAAC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>MG200186 representing NM_175102
Red=Cloning site Green=Tags(s)

MTDRYTIHSQLEHLQSKYIGTGHADTTKWEWLVNQHRDSYCSYMGHFDLLNYFAIAENESKARVRFNLME
KMLQPSGPPADKPEEN

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_175102
ORF Size 258 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_175102.4, NP_780311.2
RefSeq Size 750 bp
RefSeq ORF 261 bp
Locus ID 66125
UniProt ID Q923D4
Cytogenetics 10 A2
Summary Involved in pre-mRNA splicing as a component of the splicing factor SF3B complex, a constituent of the spliceosome. SF3B complex is required for 'A' complex assembly formed by the stable binding of U2 snRNP to the branchpoint sequence (BPS) in pre-mRNA. Sequence independent binding of SF3A/SF3B complex upstream of the branch site is essential, it may anchor U2 snRNP to the pre-mRNA.UniProtKB/Swiss-Prot Function
Reviews
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources
"NM_175102" in other vectors (3)
SKU Description Size Price
MR200186 Sf3b5 (Myc-DDK-tagged) - Mouse splicing factor 3b, subunit 5 (Sf3b5) 10 ug
$289.00
MR200186L3 Lenti ORF clone of Sf3b5 (Myc-DDK-tagged) - Mouse splicing factor 3b, subunit 5 (Sf3b5) 10 ug
$450.00
MR200186L4 Lenti ORF clone of Sf3b5 (mGFP-tagged) - Mouse splicing factor 3b, subunit 5 (Sf3b5) 10 ug
$450.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.