Atp5e (NM_025983) Mouse Tagged ORF Clone
CAT#: MG200018
- TrueORF®
Atp5e (tGFP-tagged) - Mouse ATP synthase, H+ transporting, mitochondrial F1 complex, epsilon subunit (Atp5e)
ORF Plasmid: DDK
Lentiviral Particles: DDK w/ Puro mGFP w/ Puro
AAV Particle: DDK
"NM_025983" in other vectors (4)
Specifications
Product Data | |
Type | Mouse Tagged ORF Clone |
Tag | TurboGFP |
Symbol | Atp5e |
Synonyms | 2410043G19Rik; ATPE; AV000645 |
Vector | pCMV6-AC-GFP |
E. coli Selection | Ampicillin (100 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>MG200018 representing NM_025983
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGTGGCGTACTGGCGACAGGCTGGACTCAGCTACATCCGGTTTTCCCAGATCTGTGCAAAAGCAGTGA GGGATGCCCTGAAGACCGAGTTCAAAGCGAACGCTGAGAAGACTTCGGGCAGCAGCATAAAAATTGTGAA AGTCTCGAAGAAGGAG ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA >MG200018 representing NM_025983
Red=Cloning site Green=Tags(s) MVAYWRQAGLSYIRFSQICAKAVRDALKTEFKANAEKTSGSSIKIVKVSKKE TRTRPLE - GFP Tag - V |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_025983 |
ORF Size | 156 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_025983.3, NP_080259.1 |
RefSeq Size | 419 bp |
RefSeq ORF | 159 bp |
Locus ID | 67126 |
UniProt ID | P56382 |
Cytogenetics | 2 H4 |
Gene Summary | Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core, and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F(1) domain and of the central stalk which is part of the complex rotary element. Rotation of the central stalk against the surrounding alpha(3)beta(3) subunits leads to hydrolysis of ATP in three separate catalytic sites on the beta subunits (By similarity).[UniProtKB/Swiss-Prot Function] |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
MC205835 | Atp5e (untagged) - Mouse ATP synthase, H+ transporting, mitochondrial F1 complex, epsilon subunit (Atp5e), nuclear gene encoding mitochondrial protein, (10ug) |
USD 150.00 |
|
MR200018 | Atp5e (Myc-DDK-tagged) - Mouse ATP synthase, H+ transporting, mitochondrial F1 complex, epsilon subunit (Atp5e), nuclear gene encoding mitochondrial protein |
USD 150.00 |
|
MR200018L3 | Lenti ORF clone of Atp5e (Myc-DDK-tagged) - Mouse ATP synthase, H+ transporting, mitochondrial F1 complex, epsilon subunit (Atp5e), nuclear gene encoding mitochondrial protein |
USD 450.00 |
|
MR200018L4 | Lenti ORF clone of Atp5e (mGFP-tagged) - Mouse ATP synthase, H+ transporting, mitochondrial F1 complex, epsilon subunit (Atp5e), nuclear gene encoding mitochondrial protein |
USD 450.00 |
{0} Product Review(s)
Be the first one to submit a review