Qtrt2 Rabbit Polyclonal Antibody

CAT#: TA346826

Rabbit Polyclonal Anti-Qtrtd1 Antibody

Product Images

WB Suggested Anti-Qtrtd1 Antibody; Titration: 1.0 ug/ml; Positive Control: Mouse Liver

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-Qtrtd1 antibody is: synthetic peptide directed towards the C-terminal region of Qtrtd1. Synthetic peptide located within the following region: EVLECIERGVDLFESFFPYQVTERGCALTFTFDCQLNPEETLLQQNGIQE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 38 kDa
• Gene Name: queuine tRNA-ribosyltransferase domain containing 1
• Database Link:
  NP_083404
  Entrez Gene 106248 Mouse
  UniProt ID B8ZXI1
• Background: This gene encodes a subunit of tRNA-guanine transglycosylase. tRNA-guanine transglycosylase is a heterodimeric enzyme complex that plays a critical role in tRNA modification by synthesizing the 7-deazaguanosine queuosine, which is found in tRNAs that code for asparagine, aspartic acid, histidine, and tyrosine. The encoded protein may play a role in the queuosine 5'-monophosphate salvage pathway. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
• Synonyms: FLJ12960
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Dog: 93%; Zebrafish: 93%; Guinea pig: 86%