SULT2B1 Rabbit Polyclonal Antibody

CAT#: TA346726

Rabbit Polyclonal Anti-SULT2B1 Antibody

Product Images

WB Suggested Anti-SULT2B1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: Transfected 293T

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SULT2B1 antibody: synthetic peptide directed towards the middle region of human SULT2B1. Synthetic peptide located within the following region: YSKIAGQLKDPGTPDQFLRDFLKGEVQFGSWFDHIKGWLRMKGKDNFLFI
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 39 kDa
• Gene Name: sulfotransferase family 2B member 1
• Database Link:
  NP_004596
  Entrez Gene 6820 Human
  UniProt ID O00204
• Background: Sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. These cytosolic enzymes are different in their tissue distributions and substrate specificities. The gene structure (number and length of exons) is similar among family members. This gene sulfates dehydroepiandrosterone but not 4-nitrophenol, a typical substrate for the phenol and estrogen sulfotransferase subfamilies. Two alternatively spliced variants that encode different isoforms have been described. [provided by RefSeq, Jul 2008]
• Synonyms: HSST2
• Note: Immunogen Sequence Homology: Dog: 100%; Human: 100%; Mouse: 100%; Pig: 93%; Rat: 93%; Horse: 93%; Bovine: 93%; Rabbit: 93%; Guinea pig: 92%

Reference Data

• Protein Pathways: Androgen and estrogen metabolism, Sulfur metabolism