Ceramide glucosyltransferase (UGCG) Rabbit Polyclonal Antibody

CAT#: TA346354

Rabbit Polyclonal Anti-UGCG Antibody

Product Images

WB Suggested Anti-UGCG Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 1562500; Positive Control: Human Spleen

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-UGCG antibody: synthetic peptide directed towards the N terminal of human UGCG. Synthetic peptide located within the following region: LHLNKKATDKQPYSKLPGVSLLKPLKGVDPNLINNLETFFELDYPKYEVL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 45 kDa
• Gene Name: UDP-glucose ceramide glucosyltransferase
• Database Link:
  NP_003349
  Entrez Gene 7357 Human
  UniProt ID Q16739
• Background: Glycosphingolipids (GSLs) are a group of membrane components that contain lipid and sugar moieties. They are present in essentially all animal cells and are believed to have important roles in various cellular processes. UDP-glucose ceramide glucosyltrans
• Synonyms: GCS; GLCT1
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%; Yeast: 77%

Reference Data

• Protein Families: Transmembrane
• Protein Pathways: Metabolic pathways, Sphingolipid metabolism