UGT2B15 Rabbit Polyclonal Antibody
Frequently bought together (2)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
USD 200.00
Recombinant protein of human UDP glucuronosyltransferase 2 family, polypeptide B15 (UGT2B15), 20 µg
USD 867.00
Other products for "UGT2B15"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-UGT2B15 antibody: synthetic peptide directed towards the N terminal of human UGT2B15. Synthetic peptide located within the following region: IKLEVYPTSLTKNYLEDSLLKILDRWIYGVSKNTFWSYFSQLQELCWEYY |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 61 kDa |
Gene Name | UDP glucuronosyltransferase family 2 member B15 |
Database Link | |
Background | The UGTs are of major importance in the conjugation and subsequent elimination of potentially toxic xenobiotics and endogenous compounds. UGT2B8 demonstrates reactivity with estriol. The UGTs are of major importance in the conjugation and subsequent elimination of potentially toxic xenobiotics and endogenous compounds. UGT2B8 demonstrates reactivity with estriol. See UGT2B4 (MIM 600067). [supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-1605 AF180322.1 1-1605 1606-1700 U06641.1 1547-1641 1701-1798 U08854.1 1684-1781 1799-1801 U06641.1 1779-1781 1802-1837 U06641.1 1783-1818 1838-1909 U08854.1 1822-1893 1910-2106 AF180322.1 1911-2107 2107-2144 U06641.1 2086-2123 |
Synonyms | HLUG4; UDPGT 2B8; UDPGT2B15; UDPGTH3; UGT2B8 |
Note | Immunogen Sequence Homology: Human: 100% |
Reference Data | |
Protein Families | Transmembrane |
Protein Pathways | Androgen and estrogen metabolism, Ascorbate and aldarate metabolism, Drug metabolism - cytochrome P450, Drug metabolism - other enzymes, Metabolic pathways, Metabolism of xenobiotics by cytochrome P450, Pentose and glucuronate interconversions, Porphyrin and chlorophyll metabolism, Retinol metabolism, Starch and sucrose metabolism |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.