SLC13A3 Rabbit Polyclonal Antibody

SKU TA346062

Rabbit Polyclonal Anti-SLC13A3 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SLC13A3 antibody: synthetic peptide directed towards the C terminal of human SLC13A3. Synthetic peptide located within the following region: GLSVWIGGQLHPLENVPPALAVLLITVVIAFFTEFASNTATIIIFLPVLA
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 62 kDa
• Gene Name: solute carrier family 13 member 3
• Database Link:
  NP_001011554
  Q8WWT9
• Background: Mammalian sodium-dicarboxylate cotransporters transport succinate and other Krebs cycle intermediates. They fall into 2 categories based on their substrate affinity: low affinity and high affinity. Both the low- and high-affinity transporters play an important role in the handling of citrate by the kidneys. SLC13A3 represents the high-affinity form.
• Synonyms: NADC3; SDCT2
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Rabbit: 100%; Guinea pig: 100%; Mouse: 92%; Bovine: 92%

Reference Data

• Protein Families: Druggable Genome, Transmembrane