Nac1 (NACC1) Rabbit Polyclonal Antibody

CAT#: TA345485

Rabbit Polyclonal Anti-BTBD14B Antibody

Product Images

WB Suggested Anti-BTBD14B Antibody Titration: 5.0 ug/ml; Positive Control: HepG2 cell lysate

• 

  Human Intestine

• 

  Human kidney

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-BTBD14B antibody: synthetic peptide directed towards the C terminal of human BTBD14B. Synthetic peptide located within the following region: WMPKVKVLKAEDDAYTTFISETGKIEPDMMGVEHGFETASHEGEAGPSAE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 57 kDa
• Gene Name: nucleus accumbens associated 1
• Database Link:
  NP_443108
  Entrez Gene 112939 Human
  UniProt ID Q96RE7
• Background: The function of the Anti-BTBD14B gene has not yet been determined
• Synonyms: BEND8; BTBD14B; BTBD30; NAC-1; NAC1
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Mouse: 93%; Bovine: 93%; Guinea pig: 92%; Horse: 79%

Reference Data

• Protein Families: ES Cell Differentiation/IPS, Stem cell - Pluripotency