MINA53 (MINA) Rabbit Polyclonal Antibody

SKU TA345454

Rabbit Polyclonal Anti-MINA Antibody

Product Data

• Application: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-MINA antibody: synthetic peptide directed towards the N terminal of human MINA. Synthetic peptide located within the following region: MPKKAKPTGSGKEEGPAPCKQMKLEAAGGPSALNFDSPSSLFESLISPIK
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 32 kDa
• Gene Name: MYC induced nuclear antigen
• Database Link:
  NP_694822
  Q8IUF8
• Background: MINA is a protein with a molecular weight of 53 kDa, which is localized in the nucleus and with part of the protein concentrated in the nucleolus. It is a direct target gene of Myc and is involved in mammalian cell proliferation.
• Synonyms: MDIG; MINA53; NO52; ROX
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 86%; Rat: 79%; Horse: 79%; Rabbit: 79%

Reference Data

• Protein Families: Druggable Genome